close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

The Crucible of Flame

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-06-23 Correct Ancient Flame rank 2 upgrade.
Ancient Flame (effect#1) base_value 35.00 25.00
2019-06-23 Correct Ancient Flame base damage.
Ancient Flame (effect#3) coefficient 1.23 2.28

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second39,556 (12.03%)38,414 (8.79%)38,068 (7.81%)37,567 (6.40%)37,196 (5.34%)36,722 (4.00%)36,698 (3.93%)36,691 (3.91%)36,042 (2.07%)35,773 (1.31%)35,309visionslife-forcelucid dreamsblood of the enemycrucible of flameworldveinfocusing irisunbound forcepurification protocolripple in spacebasepurification protocolMaximum: 40,461.9Upper quartile: 36,791.9Mean: 36,041.7Median: 35,990.7Lower quartile: 35,247.7Minimum: 32,184.8

Actions per Minute / DPS Variance Summary

base : 35309 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
35309.3 35309.3 24.5 / 0.069% 4259.7 / 12.1% 4284.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 35309
Heed My Call 292 (417) 0.8% (1.2%) 8.1 33.15sec 15319 0 Direct 8.1 9105 18202 10717 17.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.14 8.14 0.00 0.00 0.0000 0.0000 87218.26 87218.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 82.28% 9105.17 8901 9791 9101.98 0 9791 60971 60971 0.00
crit 1.44 17.72% 18201.91 17802 19582 14157.28 0 19582 26247 26247 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.4% 8.1 33.15sec 4602 0 Direct 8.1 3902 7805 4603 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.14 8.14 0.00 0.00 0.0000 0.0000 37452.64 37452.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 82.06% 3901.73 3815 4196 3899.99 0 4196 26057 26057 0.00
crit 1.46 17.94% 7805.30 7629 8392 6008.30 0 8392 11396 11396 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5075 14.4% 77.6 3.77sec 19553 14917 Direct 77.6 16572 33121 19553 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.62 77.62 0.00 0.00 1.3108 0.0000 1517772.57 1517772.57 0.00 14916.54 14916.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.64 81.99% 16571.61 8882 21253 16578.74 15988 17388 1054631 1054631 0.00
crit 13.98 18.01% 33121.07 17765 42507 33132.47 29641 38707 463142 463142 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2455 7.0% 14.0 21.41sec 52325 51680 Direct 14.0 2860 5719 3373 17.9%  
Periodic 221.5 2630 5255 3100 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 221.47 221.47 1.0125 1.3416 733911.78 733911.78 0.00 2357.42 51680.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.51 82.06% 2859.84 2589 3565 2861.64 2621 3123 32917 32917 0.00
crit 2.52 17.94% 5719.24 5177 7129 5348.21 0 7129 14389 14389 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.8 82.09% 2630.02 2 3319 2631.24 2562 2758 478121 478121 0.00
crit 39.7 17.91% 5254.85 3 6638 5257.05 4897 5763 208485 208485 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 797 2.3% 44.3 6.56sec 5380 0 Direct 44.3 4565 9113 5380 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.30 44.30 0.00 0.00 0.0000 0.0000 238320.14 238320.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.36 82.08% 4565.01 4180 5756 4566.64 4288 4954 165996 165996 0.00
crit 7.94 17.92% 9112.58 8360 11513 9113.17 0 11513 72324 72324 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2850 (4496) 8.1% (12.7%) 94.2 3.12sec 14267 15775 Direct 94.7 7634 15258 8995 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.20 94.71 0.00 0.00 0.9044 0.0000 851917.18 851917.18 0.00 15774.83 15774.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.81 82.15% 7634.06 6967 9594 7638.59 7369 8067 593972 593972 0.00
crit 16.91 17.85% 15257.63 13933 19188 15264.02 14049 16970 257945 257945 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1646 4.7% 74.7 3.92sec 6591 0 Direct 74.7 6591 0 6591 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.67 74.67 0.00 0.00 0.0000 0.0000 492114.19 492114.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.67 100.00% 6590.68 5086 14007 6594.44 5840 7906 492114 492114 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 11914 33.8% 61.5 4.91sec 57864 54955 Direct 61.3 49252 98387 58056 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.54 61.33 0.00 0.00 1.0529 0.0000 3560645.75 3560645.75 0.00 54955.02 54955.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.34 82.08% 49251.67 45067 61614 49274.19 47522 51871 2479341 2479341 0.00
crit 10.99 17.92% 98386.69 90135 123227 98437.03 90135 114497 1081305 1081305 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1595 4.5% 12.8 23.57sec 37363 36299 Direct 12.8 2424 4849 2858 17.9%  
Periodic 219.1 1704 3406 2009 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.76 12.76 219.13 219.13 1.0294 1.3443 476746.89 476746.89 0.00 1549.38 36298.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.48 82.11% 2423.60 2231 3073 2424.09 2231 2635 25392 25392 0.00
crit 2.28 17.89% 4848.75 4463 6146 4428.88 0 6146 11069 11069 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.9 82.08% 1704.45 2 2151 1705.23 1655 1784 306569 306569 0.00
crit 39.3 17.92% 3405.67 111 4302 3406.98 3157 3700 133717 133717 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5828 16.4% 90.0 3.10sec 19265 0 Direct 90.0 16342 32700 19266 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.95 89.95 0.00 0.00 0.0000 0.0000 1732975.64 1732975.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.88 82.13% 16342.06 15985 17583 16341.96 15985 17201 1207292 1207292 0.00
crit 16.08 17.87% 32699.97 31970 35167 32697.12 31970 34954 525683 525683 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2732 7.7% 17.8 16.75sec 45855 44699 Direct 17.8 3915 7818 4615 17.9%  
Periodic 220.6 2825 5646 3330 17.9% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.81 17.81 220.59 220.59 1.0259 1.3428 816837.90 816837.90 0.00 2597.39 44699.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.62 82.07% 3915.00 3570 4917 3915.71 3610 4239 57233 57233 0.00
crit 3.19 17.93% 7818.36 7141 9834 7574.02 0 9834 24975 24975 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 82.08% 2824.69 2 3565 2825.99 2746 2955 511426 511426 0.00
crit 39.5 17.92% 5645.55 32 7129 5647.97 5281 6108 223204 223204 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.60sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9085 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 54.1 44.0sec 4.9sec 93.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.85%
  • arcanic_pulsar_2:10.26%
  • arcanic_pulsar_3:11.32%
  • arcanic_pulsar_4:10.56%
  • arcanic_pulsar_5:13.76%
  • arcanic_pulsar_6:10.57%
  • arcanic_pulsar_7:10.74%
  • arcanic_pulsar_8:14.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.13% 7.54% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 26.01% 32.55% 0.0(0.0) 8.1

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.6sec 23.60% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.27% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.91%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.2 46.4 8.9sec 3.7sec 82.35% 99.72% 1.9(1.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.87%
  • lunar_empowerment_2:32.06%
  • lunar_empowerment_3:14.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.5sec 33.9sec 47.79% 0.00% 3.4(47.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.9 52.2 12.0sec 3.9sec 85.75% 78.97% 0.2(0.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.14%
  • solar_empowerment_2:39.96%
  • solar_empowerment_3:17.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.2 20.2sec 4.9sec 97.83% 92.79% 16.1(16.1) 11.4

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.09%
  • starlord_2:22.60%
  • starlord_3:61.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.3sec 23.68% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.68%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:base
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 61.5 2461.4 40.0 40.0 1446.6
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.20 761.58 (31.43%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.30%) 40.00 0.00 0.00%
sunfire Astral Power 17.81 53.44 (2.21%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.30 177.19 (7.31%) 4.00 0.00 0.00%
moonfire Astral Power 14.03 42.08 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.76 102.08 (4.21%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.62 931.44 (38.43%) 12.00 0.06 0.01%
natures_balance Astral Power 399.62 199.81 (8.24%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.32 75.86 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.10 8.22
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.81 0.00 70.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data base Damage Per Second
Count 7672
Mean 35309.26
Minimum 31609.83
Maximum 39466.71
Spread ( max - min ) 7856.88
Range [ ( max - min ) / 2 * 100% ] 11.13%
Standard Deviation 1096.5592
5th Percentile 33596.72
95th Percentile 37186.92
( 95th Percentile - 5th Percentile ) 3590.20
Mean Distribution
Standard Deviation 12.5192
95.00% Confidence Intervall ( 35284.72 - 35333.80 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3705
0.1 Scale Factor Error with Delta=300 10265
0.05 Scale Factor Error with Delta=300 41059
0.01 Scale Factor Error with Delta=300 1026474
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 7672
Mean 35309.26
Minimum 31609.83
Maximum 39466.71
Spread ( max - min ) 7856.88
Range [ ( max - min ) / 2 * 100% ] 11.13%
Standard Deviation 1096.5592
5th Percentile 33596.72
95th Percentile 37186.92
( 95th Percentile - 5th Percentile ) 3590.20
Mean Distribution
Standard Deviation 12.5192
95.00% Confidence Intervall ( 35284.72 - 35333.80 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3705
0.1 Scale Factor Error with Delta=300 10265
0.05 Scale Factor Error with Delta=300 41059
0.01 Scale Factor Error with Delta=300 1026474
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 7672
Mean 35309.26
Minimum 31609.83
Maximum 39466.71
Spread ( max - min ) 7856.88
Range [ ( max - min ) / 2 * 100% ] 11.13%
Damage
Sample Data base Damage
Count 7672
Mean 10545912.94
Minimum 8223227.43
Maximum 13014043.35
Spread ( max - min ) 4790815.93
Range [ ( max - min ) / 2 * 100% ] 22.71%
DTPS
Sample Data base Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.90 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 61.54 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.87 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.04 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.72 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 10.98 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.76 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 77.98 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.46 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.22 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQJQPQJQPMQPNQPQJOJQPPJPPQQQQQQJMJQPQPQIJJNPPJOQPPJMQPPQQJNPJQPQJMOPQQPQQQJQJQPJLMPPJOQPPPQIJPJQMNPJQPJQPPOQQJPJMGQPJQLPPQJPQQQQQJMOJPPPJNQPQJPQQMPJPQJOPPNJQPQJQPMPQJPQHEFJQJOQPJQNQMQPQPQPJQJPQJQPPQMNOQQJQPIJQJKPJPQPPJQPNOQQQJMJGPQPPJQPQJQPQQQQJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.181 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.115 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.048 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.859 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.859 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.859 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.612 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.366 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.121 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.875 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.727 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.480 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.235 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.989 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.809 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.565 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.321 default Q solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.076 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.863 default M sunfire Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.616 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.370 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.159 default N moonfire Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.914 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.670 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.507 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.262 default J starsurge Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.017 default O stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.773 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.528 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.282 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:24.112 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:25.066 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2)
0:25.975 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:27.098 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:28.221 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:28.975 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3)
0:29.728 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:30.609 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:31.492 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:32.374 default Q solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(8), starlord(3)
0:33.257 default J starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3)
0:34.140 default M sunfire Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:34.909 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:35.675 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:36.431 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
0:37.408 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
0:38.162 default P lunar_strike Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3)
0:39.140 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:39.908 default I cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3)
0:39.908 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment
0:40.743 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
0:41.675 default N moonfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:42.850 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2)
0:44.350 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:45.850 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2)
0:47.027 default O stellar_flare Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:48.173 default Q solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:49.146 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
0:50.606 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
0:52.066 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:53.212 default M sunfire Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
0:54.356 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
0:55.327 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
0:56.787 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:58.247 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
0:59.220 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
1:00.193 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), torrent_of_elements
1:01.440 default N moonfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:02.651 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:04.197 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord
1:05.409 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
1:06.411 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:07.911 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:08.914 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2)
1:10.090 default M sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:11.235 default O stellar_flare Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:12.381 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:13.841 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:14.816 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:15.790 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3)
1:17.249 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), starlord(3)
1:18.393 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), starlord(3)
1:19.539 default Q solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), starlord(3)
1:20.686 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8)
1:21.936 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:22.831 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power celestial_alignment, lunar_empowerment(2), starlord
1:23.887 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
1:24.756 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2)
1:26.061 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:27.086 default L moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:28.082 default M sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:29.228 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:30.688 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24)
1:32.024 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:33.082 default O stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers
1:34.142 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers
1:35.047 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers
1:36.406 default P lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers
1:37.773 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
1:39.144 default Q solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
1:40.068 default I cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
1:40.068 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, overwhelming_power(14), conch_of_dark_whispers
1:41.253 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(13), conch_of_dark_whispers
1:42.726 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(12), conch_of_dark_whispers
1:43.886 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(11), conch_of_dark_whispers
1:44.848 default M sunfire Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), conch_of_dark_whispers
1:45.984 default N moonfire Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), conch_of_dark_whispers
1:47.123 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7)
1:48.584 default J starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6)
1:49.734 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5)
1:50.689 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
1:52.124 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2)
1:53.263 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power
1:54.232 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:55.690 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:57.148 default O stellar_flare Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:58.293 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:59.267 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:00.240 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(7), lunar_empowerment
2:01.489 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord
2:03.032 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:04.245 default M sunfire Fluffy_Pillow 15.5/100: 16% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:05.270 default G use_items Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:05.270 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse
2:06.106 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse
2:07.357 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), ignition_mages_fuse
2:08.341 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse
2:09.154 default L moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse
2:10.110 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:11.455 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:12.799 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:13.696 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:14.714 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:16.011 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:16.875 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:17.738 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:18.717 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:19.696 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, ignition_mages_fuse(4)
2:20.676 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(2), lunar_empowerment, torrent_of_elements, ignition_mages_fuse(4)
2:21.742 default M sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse(5)
2:22.743 default O stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.743 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.742 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.980 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:27.482 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:28.983 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:30.160 default N moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:31.306 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:32.278 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:33.739 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:34.712 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
2:35.856 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:37.315 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:38.287 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:39.261 default M sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3)
2:40.408 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3)
2:41.867 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), solar_empowerment
2:43.117 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord
2:44.663 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord
2:45.694 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:46.908 default O stellar_flare Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25)
2:47.986 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
2:49.361 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22)
2:50.746 default N moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21)
2:51.837 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20)
2:52.932 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19)
2:53.724 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
2:54.914 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
2:55.709 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16)
2:56.651 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
2:57.426 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
2:58.590 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
2:59.642 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
3:00.989 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
3:01.892 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, overwhelming_power(20)
3:03.053 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
3:04.499 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), solar_empowerment, starlord, overwhelming_power(17)
3:05.467 default H celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, starlord, overwhelming_power(16)
3:06.462 default E potion Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(2), celestial_alignment, starlord, overwhelming_power(15)
3:06.462 default F berserking Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(2), celestial_alignment, starlord, overwhelming_power(15), battle_potion_of_intellect
3:06.462 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord, overwhelming_power(15), battle_potion_of_intellect
3:07.369 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(14), battle_potion_of_intellect
3:08.125 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(13), battle_potion_of_intellect
3:09.015 default O stellar_flare Fluffy_Pillow 12.0/100: 12% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:09.883 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:10.637 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:11.744 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:12.617 default Q solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:13.369 default N moonfire Fluffy_Pillow 10.5/100: 11% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:14.248 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:15.133 default M sunfire Fluffy_Pillow 23.0/100: 23% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(6), battle_potion_of_intellect
3:16.020 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:16.909 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:18.041 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:18.937 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:20.193 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power, battle_potion_of_intellect
3:21.185 default P lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect
3:22.453 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(5), celestial_alignment, solar_empowerment, battle_potion_of_intellect
3:23.540 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:24.436 default J starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:25.492 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:26.992 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:27.993 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:29.171 default Q solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:30.062 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:31.404 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:32.752 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
3:33.657 default M sunfire Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers
3:34.723 default N moonfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers
3:35.791 default O stellar_flare Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers
3:36.862 default Q solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
3:37.776 default Q solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), conch_of_dark_whispers
3:38.858 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), conch_of_dark_whispers
3:39.941 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), conch_of_dark_whispers
3:40.746 default P lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(13)
3:41.958 default I cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power celestial_alignment, starlord(3), overwhelming_power(12)
3:41.958 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power celestial_alignment, overwhelming_power(12)
3:42.996 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), conch_of_dark_whispers
3:43.856 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(10), conch_of_dark_whispers
3:44.871 default K sunfire Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9), conch_of_dark_whispers
3:45.863 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(8), conch_of_dark_whispers
3:47.318 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(6), conch_of_dark_whispers
3:48.469 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
3:49.900 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers
3:50.860 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers
3:52.305 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers
3:53.758 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:54.903 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
3:55.877 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:57.336 default N moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
3:58.383 default O stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:59.433 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
4:00.330 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
4:01.230 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(21), conch_of_dark_whispers
4:02.291 default J starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(4), lunar_empowerment, overwhelming_power(20), conch_of_dark_whispers
4:03.451 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(19), conch_of_dark_whispers
4:04.584 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), conch_of_dark_whispers
4:05.719 default G use_items Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17), conch_of_dark_whispers
4:05.719 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse
4:07.074 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse
4:07.986 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse
4:09.350 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13), ignition_mages_fuse
4:10.726 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(25), ignition_mages_fuse(2)
4:11.724 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), ignition_mages_fuse(2)
4:12.554 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.800 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(3)
4:14.604 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.554 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.365 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.583 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.400 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.192 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.123 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.059 default J starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.995 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

blood of the enemy : 37567 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
37567.4 37567.4 29.1 / 0.077% 4979.6 / 13.3% 4575.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.1 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 37567
Blood of the Enemy 362 1.0% 3.7 91.20sec 29422 30628 Direct 3.7 22901 57286 29425 19.0%  

Stats details: blood_of_the_enemy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 3.68 0.00 0.00 0.9607 0.0000 108178.02 108178.02 0.00 30627.98 30627.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.98 81.03% 22900.70 22467 24714 22834.10 0 24714 68230 68230 0.00
crit 0.70 18.97% 57285.85 56168 61785 30939.22 0 61785 39948 39948 0.00
 
 

Action details: blood_of_the_enemy

Static Values
  • id:297108
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.ca_inc.remains>30
Spelldata
  • id:297108
  • name:Blood of the Enemy
  • school:shadow
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing {$s1=5936} Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20460.77
  • base_dd_max:20460.77
  • base_dd_mult:1.00
 
Heed My Call 309 (442) 0.8% (1.2%) 8.2 32.75sec 16054 0 Direct 8.2 9108 18716 11230 22.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 92568.44 92568.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 77.92% 9108.25 8901 9791 9106.93 0 9791 58498 58498 0.00
crit 1.82 22.08% 18716.01 17802 24477 15934.32 0 24477 34070 34070 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 133 0.4% 8.2 32.75sec 4824 0 Direct 8.2 3903 8016 4824 22.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.24 8.24 0.00 0.00 0.0000 0.0000 39765.84 39765.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.40 77.61% 3903.43 3815 4196 3901.63 0 4196 24971 24971 0.00
crit 1.85 22.39% 8015.69 7629 10490 6803.24 0 10490 14795 14795 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5226 13.9% 77.1 3.79sec 20265 15592 Direct 77.1 16499 33959 20265 21.6%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.11 77.11 0.00 0.00 1.2997 0.0000 1562543.07 1562543.07 0.00 15592.22 15592.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.48 78.43% 16499.06 8882 21253 16504.85 15878 17306 997797 997797 0.00
crit 16.63 21.57% 33959.48 17765 53133 33999.70 30174 39003 564746 564746 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2608 6.9% 14.0 21.41sec 55519 55069 Direct 14.0 2847 5932 3517 21.7%  
Periodic 223.5 2617 5512 3266 22.4% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 223.48 223.48 1.0082 1.3295 779165.39 779165.39 0.00 2503.25 55068.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.99 78.30% 2846.98 2589 3565 2848.10 2589 3123 31284 31284 0.00
crit 3.05 21.70% 5931.87 5177 8912 5755.25 0 8912 18068 18068 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.4 77.58% 2616.52 3 3319 2617.63 2533 2747 453619 453619 0.00
crit 50.1 22.42% 5511.91 18 8297 5516.92 5122 6099 276195 276195 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 845 2.3% 44.6 6.54sec 5664 0 Direct 44.6 4541 9548 5664 22.4%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.59 44.59 0.00 0.00 0.0000 0.0000 252525.84 252525.84 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.59 77.58% 4541.24 4180 5756 4542.71 4287 4937 157090 157090 0.00
crit 10.00 22.42% 9548.10 8360 14391 9553.37 8360 12075 95435 95435 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2961 (4683) 7.9% (12.5%) 93.7 3.13sec 14938 16628 Direct 94.2 7588 15695 9392 22.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.68 94.19 0.00 0.00 0.8984 0.0000 884636.32 884636.32 0.00 16627.89 16627.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.24 77.75% 7588.26 6967 9594 7592.17 7303 7973 555728 555728 0.00
crit 20.96 22.25% 15694.51 13933 23984 15709.83 14320 17837 328908 328908 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1723 4.6% 74.3 3.94sec 6928 0 Direct 74.3 6928 0 6928 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.31 74.31 0.00 0.00 0.0000 0.0000 514833.46 514833.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.31 100.00% 6927.83 5086 17509 6934.62 5940 8113 514833 514833 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 12554 33.4% 61.3 4.92sec 61188 58588 Direct 61.1 48967 103756 61383 22.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.29 61.09 0.00 0.00 1.0444 0.0000 3750148.63 3750148.63 0.00 58587.83 58587.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.25 77.34% 48966.55 45067 61614 48984.14 46946 51205 2313513 2313513 0.00
crit 13.85 22.66% 103756.03 90135 154034 103918.44 90135 126310 1436636 1436636 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1694 4.5% 12.8 23.57sec 39674 38696 Direct 12.8 2409 5122 2998 21.7%  
Periodic 221.1 1696 3573 2116 22.4% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.76 12.76 221.14 221.14 1.0253 1.3320 506294.05 506294.05 0.00 1645.70 38695.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.99 78.29% 2408.58 2231 3073 2408.13 2231 2723 24063 24063 0.00
crit 2.77 21.71% 5122.06 4463 7683 4929.47 0 7683 14192 14192 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.6 77.59% 1695.97 7 2151 1696.67 1650 1777 291018 291018 0.00
crit 49.5 22.41% 3572.70 24 5378 3576.05 3328 3942 177021 177021 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6260 16.6% 88.6 3.14sec 21002 0 Direct 88.6 16355 34117 21002 26.2%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.59 88.59 0.00 0.00 0.0000 0.0000 1860496.65 1860496.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.41 73.84% 16354.72 15985 17583 16354.60 15985 17213 1069799 1069799 0.00
crit 23.18 26.16% 34116.88 31970 43958 34128.62 31970 37847 790698 790698 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2894 7.7% 17.8 16.74sec 48506 47643 Direct 17.8 3902 8036 4779 21.2%  
Periodic 222.7 2811 5907 3502 22.3% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.83 17.83 222.66 222.66 1.0182 1.3304 864859.36 864859.36 0.00 2750.89 47642.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.05 78.77% 3901.53 3570 4917 3901.81 3632 4255 54798 54798 0.00
crit 3.78 21.23% 8035.53 7141 12292 7937.42 0 12292 30413 30413 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.0 77.70% 2811.23 5 3565 2812.42 2722 2945 486383 486383 0.00
crit 49.6 22.30% 5906.81 69 8912 5911.95 5500 6557 293266 293266 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.57sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.73sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9033 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.9 44.2sec 4.9sec 93.30% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.68%
  • arcanic_pulsar_2:10.26%
  • arcanic_pulsar_3:11.67%
  • arcanic_pulsar_4:10.85%
  • arcanic_pulsar_5:13.51%
  • arcanic_pulsar_6:10.29%
  • arcanic_pulsar_7:10.63%
  • arcanic_pulsar_8:14.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.7sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.13% 7.67% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 5.2 0.0 57.7sec 57.7sec 13.74% 0.00% 0.0(0.0) 5.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:592.56

Stack Uptimes

  • bloodsoaked_1:13.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 4.8 207.7 65.6sec 1.4sec 86.91% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.09

Stack Uptimes

  • bloodsoaked_counter_1:2.49%
  • bloodsoaked_counter_2:2.28%
  • bloodsoaked_counter_3:2.12%
  • bloodsoaked_counter_4:2.05%
  • bloodsoaked_counter_5:2.03%
  • bloodsoaked_counter_6:1.97%
  • bloodsoaked_counter_7:1.95%
  • bloodsoaked_counter_8:1.94%
  • bloodsoaked_counter_9:1.90%
  • bloodsoaked_counter_10:5.89%
  • bloodsoaked_counter_11:2.48%
  • bloodsoaked_counter_12:2.42%
  • bloodsoaked_counter_13:2.42%
  • bloodsoaked_counter_14:2.39%
  • bloodsoaked_counter_15:2.35%
  • bloodsoaked_counter_16:2.33%
  • bloodsoaked_counter_17:2.30%
  • bloodsoaked_counter_18:2.28%
  • bloodsoaked_counter_19:2.25%
  • bloodsoaked_counter_20:2.24%
  • bloodsoaked_counter_21:2.19%
  • bloodsoaked_counter_22:2.18%
  • bloodsoaked_counter_23:2.13%
  • bloodsoaked_counter_24:2.13%
  • bloodsoaked_counter_25:2.12%
  • bloodsoaked_counter_26:2.09%
  • bloodsoaked_counter_27:2.07%
  • bloodsoaked_counter_28:2.07%
  • bloodsoaked_counter_29:2.06%
  • bloodsoaked_counter_30:2.03%
  • bloodsoaked_counter_31:2.04%
  • bloodsoaked_counter_32:2.03%
  • bloodsoaked_counter_33:1.99%
  • bloodsoaked_counter_34:1.99%
  • bloodsoaked_counter_35:1.98%
  • bloodsoaked_counter_36:1.97%
  • bloodsoaked_counter_37:1.93%
  • bloodsoaked_counter_38:1.93%
  • bloodsoaked_counter_39:1.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 25.97% 32.38% 0.0(0.0) 8.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.4sec 23.71% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.27% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 46.1 8.9sec 3.7sec 82.07% 99.81% 1.9(1.9) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.95%
  • lunar_empowerment_2:31.72%
  • lunar_empowerment_3:14.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.1sec 33.8sec 48.09% 0.00% 3.5(48.3) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Seething Rage 3.7 0.0 91.2sec 91.2sec 6.11% 0.00% 0.0(0.0) 3.6

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_seething_rage
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • seething_rage_1:6.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297126
  • name:Seething Rage
  • tooltip:Critical strike damage increased by $w1%.
  • description:{$@spelldesc297122=Increases your critical hit damage by $297126m% for {$297126d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.9 51.8 11.9sec 3.9sec 85.95% 79.02% 0.2(0.2) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.62%
  • solar_empowerment_2:39.78%
  • solar_empowerment_3:17.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.0 20.2sec 4.9sec 97.79% 93.02% 15.8(15.8) 11.5

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.63%
  • starlord_2:22.48%
  • starlord_3:60.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.7sec 23.69% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.69%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 61.3 2451.5 40.0 40.0 1529.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 94.68 757.40 (31.38%) 8.00 0.07 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.31%) 40.00 0.00 0.00%
sunfire Astral Power 17.83 53.49 (2.22%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.59 178.33 (7.39%) 4.00 0.01 0.01%
moonfire Astral Power 14.03 42.10 (1.74%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.76 102.09 (4.23%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.11 925.22 (38.33%) 12.00 0.06 0.01%
natures_balance Astral Power 399.62 199.80 (8.28%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.29 75.54 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.06 8.19
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.48 0.00 82.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data blood of the enemy Damage Per Second
Count 7672
Mean 37567.41
Minimum 33143.67
Maximum 42342.97
Spread ( max - min ) 9199.30
Range [ ( max - min ) / 2 * 100% ] 12.24%
Standard Deviation 1300.0830
5th Percentile 35522.56
95th Percentile 39744.89
( 95th Percentile - 5th Percentile ) 4222.33
Mean Distribution
Standard Deviation 14.8428
95.00% Confidence Intervall ( 37538.32 - 37596.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4601
0.1 Scale Factor Error with Delta=300 14429
0.05 Scale Factor Error with Delta=300 57715
0.01 Scale Factor Error with Delta=300 1442866
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 7672
Mean 37567.41
Minimum 33143.67
Maximum 42342.97
Spread ( max - min ) 9199.30
Range [ ( max - min ) / 2 * 100% ] 12.24%
Standard Deviation 1300.0830
5th Percentile 35522.56
95th Percentile 39744.89
( 95th Percentile - 5th Percentile ) 4222.33
Mean Distribution
Standard Deviation 14.8428
95.00% Confidence Intervall ( 37538.32 - 37596.51 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 47
0.1% Error 4601
0.1 Scale Factor Error with Delta=300 14429
0.05 Scale Factor Error with Delta=300 57715
0.01 Scale Factor Error with Delta=300 1442866
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 7672
Mean 37567.41
Minimum 33143.67
Maximum 42342.97
Spread ( max - min ) 9199.30
Range [ ( max - min ) / 2 * 100% ] 12.24%
Damage
Sample Data blood of the enemy Damage
Count 7672
Mean 11216015.09
Minimum 8742036.37
Maximum 13889584.08
Spread ( max - min ) 5147547.71
Range [ ( max - min ) / 2 * 100% ] 22.95%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
H 3.68 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.87 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.29 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.83 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 3.00 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.74 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.04 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.76 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.46 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 93.95 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.26 sunfire

Sample Sequence

0123456789ACDKONPIFGHKRKRQRKRQRQKNRQORQRKPKRQQKQQRQRRRRKNKRQRQRMKKQQKPRQKNRQRKQQRQKOQRKQNPRKRQRQRMRRKKQRNQKRQPKHRQRRROKQKNRQRRKQQPKRQRRNKGORQKRLQQKQRQKQRPQRRKOQKNQRRKQQRRKQRRRKNOPQKRQKRQLQKQRRIEFHKRKPORQKRQRKNRQRKRQMQQKQRKRPRQKLQQKQRQOKRQRNKQRPKQRRRQGRRKKONQQKRQRRRRKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.248 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.181 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:03.114 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter, battle_potion_of_intellect
0:04.049 default I celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.862 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.862 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect
0:04.862 default H blood_of_the_enemy Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:05.618 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.372 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.126 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.880 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(5), battle_potion_of_intellect, ignition_mages_fuse
0:08.633 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(7), battle_potion_of_intellect, ignition_mages_fuse
0:09.485 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(9), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.240 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(11), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.995 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), bloodsoaked_counter(13), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.749 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), bloodsoaked_counter(15), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.569 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(16), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.322 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.109 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(20), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.864 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.618 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.373 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.163 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.920 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(26), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.676 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked_counter(27), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.513 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), bloodsoaked_counter(28), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.269 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, bloodsoaked_counter(28), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.026 default P stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(30), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.780 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(33), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.533 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), bloodsoaked_counter(33), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.287 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), bloodsoaked_counter(34), ignition_mages_fuse(5)
0:24.117 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(36), ignition_mages_fuse(5)
0:25.070 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), bloodsoaked_counter(36)
0:25.977 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(37)
0:27.102 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(38)
0:28.226 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), bloodsoaked_counter(39)
0:28.979 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(39)
0:30.103 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), bloodsoaked_counter(39)
0:30.857 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked
0:31.612 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked
0:32.436 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked
0:33.260 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked
0:34.082 default N sunfire Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked
0:34.836 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked
0:35.590 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked
0:36.344 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked
0:37.257 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked
0:38.012 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked
0:38.924 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3)
0:39.682 default M moonfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), bloodsoaked_counter(2)
0:40.450 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar, bloodsoaked_counter(2)
0:41.411 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(3)
0:42.623 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24), bloodsoaked_counter(3)
0:44.000 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(3)
0:45.384 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(21), bloodsoaked_counter(3)
0:46.474 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), bloodsoaked_counter(4)
0:47.540 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19), bloodsoaked_counter(5)
0:48.449 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(6)
0:49.816 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(17), bloodsoaked_counter(7)
0:50.891 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), bloodsoaked_counter(9)
0:51.973 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15), bloodsoaked_counter(11)
0:52.894 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter(11)
0:54.280 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked_counter(11)
0:55.212 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(11), bloodsoaked_counter(11)
0:56.311 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked_counter(12)
0:57.718 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked_counter(14)
0:59.129 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(7), bloodsoaked_counter(15)
1:00.078 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), bloodsoaked_counter(16)
1:01.505 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), solar_empowerment, overwhelming_power(5), bloodsoaked_counter(16)
1:02.730 default O moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4), bloodsoaked_counter(18)
1:03.924 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(3), bloodsoaked_counter(19)
1:05.451 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, overwhelming_power, bloodsoaked_counter(20)
1:06.477 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), solar_empowerment, starlord, bloodsoaked_counter(21), conch_of_dark_whispers
1:07.690 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(22), conch_of_dark_whispers
1:09.191 default N sunfire Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(23), conch_of_dark_whispers
1:10.367 default P stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(24), conch_of_dark_whispers
1:11.545 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(26), conch_of_dark_whispers
1:12.547 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), bloodsoaked_counter(26), conch_of_dark_whispers
1:13.724 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(27), conch_of_dark_whispers
1:14.570 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(28), conch_of_dark_whispers
1:15.839 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, solar_empowerment, starlord(3), bloodsoaked_counter(29), conch_of_dark_whispers
1:16.688 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, starlord(3), bloodsoaked_counter(31), conch_of_dark_whispers
1:18.184 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power celestial_alignment, starlord(3), bloodsoaked_counter(32), conch_of_dark_whispers
1:19.182 default M moonfire Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, starlord(3), bloodsoaked_counter(32), conch_of_dark_whispers
1:20.180 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power starlord(3), bloodsoaked_counter(36), conch_of_dark_whispers
1:21.326 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power starlord(3), bloodsoaked_counter(36)
1:22.470 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power bloodsoaked_counter(36)
1:23.719 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(36)
1:24.932 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(37)
1:26.433 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(2), bloodsoaked_counter(38)
1:27.432 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(38)
1:28.609 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(10), bloodsoaked
1:30.007 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(10), bloodsoaked
1:31.105 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:32.014 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:33.374 default P stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:34.443 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:35.512 default H blood_of_the_enemy Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(10), bloodsoaked
1:36.582 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(10)
1:37.556 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power seething_rage, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(10)
1:39.017 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power seething_rage, arcanic_pulsar(4), solar_empowerment(2), starlord(3), bloodsoaked_counter(10)
1:39.990 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power seething_rage, arcanic_pulsar(4), solar_empowerment, starlord(3), bloodsoaked_counter(11)
1:40.962 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), starlord(3), bloodsoaked_counter(11)
1:42.109 default O moonfire Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), starlord(3), bloodsoaked_counter(14)
1:43.255 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(4), bloodsoaked_counter(15)
1:44.504 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, bloodsoaked_counter(15)
1:46.046 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements, bloodsoaked_counter(17)
1:47.257 default N sunfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(18)
1:48.435 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(18)
1:49.437 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(18)
1:50.937 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), torrent_of_elements, bloodsoaked_counter(20)
1:51.939 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements, bloodsoaked_counter(20)
1:52.940 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, bloodsoaked_counter(20)
1:54.116 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(21)
1:55.574 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), bloodsoaked_counter(22)
1:56.910 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(23)
1:57.965 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(23)
1:59.022 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(23)
1:59.926 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(23)
2:01.285 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(24)
2:02.197 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(25)
2:03.113 default N sunfire Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), bloodsoaked_counter(25)
2:04.194 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), overwhelming_power(15), bloodsoaked_counter(26)
2:05.376 default G use_items Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), bloodsoaked_counter(27)
2:05.376 default O moonfire Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), bloodsoaked_counter(27), ignition_mages_fuse
2:06.340 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13), bloodsoaked_counter(27), ignition_mages_fuse
2:07.162 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(12), bloodsoaked_counter(30), ignition_mages_fuse
2:08.397 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, starlord, overwhelming_power(11), bloodsoaked_counter(31), ignition_mages_fuse
2:09.370 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(10), bloodsoaked_counter(32), ignition_mages_fuse
2:10.175 default L sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(9), bloodsoaked_counter(32), ignition_mages_fuse(2)
2:11.093 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(2), overwhelming_power(8), bloodsoaked_counter(33), ignition_mages_fuse(2)
2:12.440 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), overwhelming_power(7), bloodsoaked_counter(35), ignition_mages_fuse(2)
2:13.792 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, starlord(2), overwhelming_power(6), bloodsoaked_counter(36), ignition_mages_fuse(3)
2:14.817 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(37), ignition_mages_fuse(3)
2:16.092 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(3), bloodsoaked_counter(37), ignition_mages_fuse(3)
2:16.949 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(3), bloodsoaked_counter(37), ignition_mages_fuse(3)
2:18.231 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power, bloodsoaked_counter(39), ignition_mages_fuse(4)
2:19.207 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked, ignition_mages_fuse(4)
2:20.383 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), bloodsoaked, ignition_mages_fuse(4)
2:21.166 default P stellar_flare Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked, ignition_mages_fuse(4)
2:22.027 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked, ignition_mages_fuse(5)
2:23.092 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(22), bloodsoaked, ignition_mages_fuse(5)
2:23.930 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(22), bloodsoaked, ignition_mages_fuse(5)
2:24.771 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), torrent_of_elements, overwhelming_power(21), bloodsoaked, ignition_mages_fuse(5)
2:25.688 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), bloodsoaked
2:26.744 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), bloodsoaked
2:28.093 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17)
2:29.235 default N sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter
2:30.344 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(3)
2:31.765 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(5)
2:32.715 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), bloodsoaked_counter(5)
2:33.669 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), bloodsoaked_counter(5)
2:34.795 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), bloodsoaked_counter(6)
2:36.195 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), bloodsoaked_counter(6)
2:37.607 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), bloodsoaked_counter(7)
2:38.554 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(8)
2:39.671 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(6), bloodsoaked_counter(9)
2:40.791 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(12)
2:42.223 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(3), bloodsoaked_counter(13)
2:43.187 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(2), bloodsoaked_counter(13)
2:44.322 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power, bloodsoaked_counter(13)
2:45.463 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment, bloodsoaked_counter(14)
2:46.710 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(14)
2:47.923 default O moonfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(14)
2:49.134 default P stellar_flare Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, bloodsoaked_counter(15)
2:50.347 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(25), bloodsoaked_counter(16)
2:51.758 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), bloodsoaked_counter(16)
2:52.869 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), bloodsoaked_counter(17)
2:53.673 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), bloodsoaked_counter(17)
2:54.877 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(21), bloodsoaked_counter(17)
2:55.827 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), bloodsoaked_counter(17)
2:56.613 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(17)
2:57.798 default L sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter(17)
2:58.732 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(18)
3:00.102 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(15), bloodsoaked_counter(18)
3:01.189 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter(19)
3:02.575 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(22)
3:03.503 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(22)
3:04.435 default I celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), celestial_alignment, starlord(3), overwhelming_power(11), bloodsoaked_counter(22)
3:05.392 default E potion Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), celestial_alignment, starlord(3), overwhelming_power(10), bloodsoaked_counter(22)
3:05.392 default F berserking Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), celestial_alignment, starlord(3), overwhelming_power(10), bloodsoaked_counter(22), battle_potion_of_intellect
3:05.392 default H blood_of_the_enemy Fluffy_Pillow 84.5/100: 85% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord(3), overwhelming_power(10), bloodsoaked_counter(22), battle_potion_of_intellect
3:06.464 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, overwhelming_power(9), bloodsoaked_counter(24), battle_potion_of_intellect
3:07.418 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(26), battle_potion_of_intellect
3:08.209 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, starlord, overwhelming_power(7), bloodsoaked_counter(28), battle_potion_of_intellect
3:09.143 default P stellar_flare Fluffy_Pillow 19.0/100: 19% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(6), bloodsoaked_counter(29), battle_potion_of_intellect
3:10.054 default O moonfire Fluffy_Pillow 27.5/100: 28% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(5), bloodsoaked_counter(32), battle_potion_of_intellect
3:10.966 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(5), bloodsoaked_counter(33), battle_potion_of_intellect
3:11.745 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(4), bloodsoaked_counter(36), conch_of_dark_whispers, battle_potion_of_intellect
3:12.914 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(3), bloodsoaked_counter(39), conch_of_dark_whispers, battle_potion_of_intellect
3:13.836 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(2), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:14.591 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:15.582 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:16.362 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:17.144 default N sunfire Fluffy_Pillow 7.0/100: 7% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:17.928 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:18.684 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:19.786 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:20.653 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect
3:21.526 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:22.319 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:23.514 default M moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(3), conch_of_dark_whispers, battle_potion_of_intellect
3:24.454 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked_counter(4), conch_of_dark_whispers, battle_potion_of_intellect
3:25.837 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(14), bloodsoaked_counter(6), conch_of_dark_whispers, battle_potion_of_intellect
3:27.224 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), overwhelming_power(12), bloodsoaked_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:28.420 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), bloodsoaked_counter(8), conch_of_dark_whispers, battle_potion_of_intellect
3:29.902 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(10), bloodsoaked_counter(9), conch_of_dark_whispers, battle_potion_of_intellect
3:30.895 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), starlord, overwhelming_power(9), bloodsoaked_counter(9), conch_of_dark_whispers
3:32.068 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(7), bloodsoaked_counter(10), conch_of_dark_whispers
3:32.916 default P stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(7), bloodsoaked_counter(12), conch_of_dark_whispers
3:33.915 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(6), bloodsoaked_counter(16), conch_of_dark_whispers
3:34.918 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(5), bloodsoaked_counter(16), conch_of_dark_whispers
3:36.197 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(3), bloodsoaked_counter(17), conch_of_dark_whispers
3:37.209 default L sunfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), bloodsoaked_counter(19), conch_of_dark_whispers
3:38.199 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, bloodsoaked_counter(21), conch_of_dark_whispers
3:39.652 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(25)
3:41.111 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(26)
3:42.257 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(27)
3:43.716 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, bloodsoaked_counter(27)
3:44.689 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(28)
3:46.150 default O moonfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(29)
3:47.296 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), solar_empowerment(2), torrent_of_elements, bloodsoaked_counter(29)
3:48.545 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(30)
3:49.576 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(30)
3:51.118 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, bloodsoaked_counter(31)
3:52.149 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), solar_empowerment, starlord, bloodsoaked_counter(32)
3:53.363 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), solar_empowerment, starlord, bloodsoaked_counter(33)
3:54.575 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(33)
3:56.074 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), bloodsoaked_counter(33)
3:57.075 default P stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), bloodsoaked_counter(33)
3:58.251 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), bloodsoaked_counter(35)
3:59.429 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(35)
4:00.889 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), bloodsoaked_counter(36)
4:01.863 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), bloodsoaked_counter(37)
4:02.837 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), starlord(3), bloodsoaked_counter(38)
4:03.982 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), bloodsoaked_counter(38)
4:05.442 default G use_items Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), starlord(3), bloodsoaked
4:05.442 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), starlord(3), bloodsoaked, ignition_mages_fuse
4:06.469 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(5), starlord(3), bloodsoaked, ignition_mages_fuse
4:07.499 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(5), bloodsoaked, ignition_mages_fuse
4:08.620 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, bloodsoaked, ignition_mages_fuse
4:09.708 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked, ignition_mages_fuse(2)
4:10.727 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked, ignition_mages_fuse(2)
4:11.746 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked, ignition_mages_fuse(2)
4:13.044 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked, ignition_mages_fuse(2)
4:14.341 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(24), bloodsoaked_counter(2), ignition_mages_fuse(3)
4:15.309 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23), bloodsoaked_counter(3), ignition_mages_fuse(3)
4:16.114 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), bloodsoaked_counter(3), ignition_mages_fuse(3)
4:17.320 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(3), ignition_mages_fuse(3)
4:18.129 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked_counter(3), ignition_mages_fuse(4)
4:18.912 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), bloodsoaked_counter(4), ignition_mages_fuse(4)
4:19.833 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19), bloodsoaked_counter(4), ignition_mages_fuse(4)
4:20.755 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18), bloodsoaked_counter(4), ignition_mages_fuse(4)
4:21.681 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(4), conch_of_dark_whispers, ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

crucible of flame : 37196 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
37196.5 37196.5 26.1 / 0.070% 4545.4 / 12.2% 4695.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
7.9 7.8 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
crucible of flame 37196
Ancient Flame 1255 3.4% 24.9 11.71sec 15103 0 Periodic 89.7 3545 7094 4185 18.0% 57.9%

Stats details: ancient_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.85 0.00 89.69 89.69 0.0000 1.9315 375369.13 375369.13 0.00 2166.87 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.5 81.96% 3544.86 2 6423 3525.62 2071 5075 260593 260593 0.00
crit 16.2 18.04% 7094.47 4 12846 7053.59 3765 11246 114776 114776 0.00
 
 

Action details: ancient_flame

Static Values
  • id:295367
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295367
  • name:Ancient Flame
  • school:fire
  • tooltip:Suffering $w1 fire damage every $t1 sec.
  • description:{$@spelldesc295365=Your spells and abilities have a chance to cauterize your target for ${$m3*5} Fire damage over {$295367d=10 seconds} or healing an ally for ${$m3*5} over {$295367d=10 seconds}$?a295369[, stacking up to {$295367u=1} times][].}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:1313.31
  • base_td_mult:1.35
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Concentrated Flame 0 (1881) 0.0% (5.1%) 11.5 29.90sec 49055 45380

Stats details: concentrated_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.47 0.00 0.00 0.00 1.0810 0.0000 0.00 0.00 0.00 45379.67 45379.67
 
 

Action details: concentrated_flame

Static Values
  • id:295373
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295373
  • name:Concentrated Flame
  • school:fire
  • tooltip:
  • description:Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.
 
    Concentrated Flame (_missile) 1140 3.1% 11.5 29.90sec 29721 0 Direct 11.5 25118 50972 29722 17.8%  

Stats details: concentrated_flame_missile

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.47 11.47 0.00 0.00 0.0000 0.0000 340789.97 340789.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.42 82.20% 25117.52 12753 42084 25079.47 17004 32611 236729 236729 0.00
crit 2.04 17.80% 50971.78 25506 84168 45646.40 0 84168 104061 104061 0.00
 
 

Action details: concentrated_flame_missile

Static Values
  • id:295374
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295374
  • name:Concentrated Flame
  • school:fire
  • tooltip:
  • description:{$@spelldesc295373=Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:11614.19
  • base_dd_max:11614.19
  • base_dd_mult:1.00
 
    Concentrated Flame (_burn) 741 2.0% 11.5 29.90sec 19334 0 Periodic 32.0 6928 0 6928 0.0% 21.4%

Stats details: concentrated_flame_burn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.47 0.00 32.00 32.00 0.0000 2.0000 221690.99 221690.99 0.00 3464.03 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.0 100.00% 6927.95 3347 11047 6925.85 6695 7579 221691 221691 0.00
 
 

Action details: concentrated_flame_burn

Static Values
  • id:295368
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295368
  • name:Concentrated Flame
  • school:fire
  • tooltip:Suffering $w1 damage every $t1 sec.
  • description:{$@spelldesc295373=Blast your target with a ball of concentrated flame, dealing ${{$295365s2=3369}*(1+$@versadmg)} Fire damage to an enemy or healing an ally for ${{$295365s2=3369}*(1+$@versadmg)}$?a295377[, then burn the target for an additional $295377m1% of the damage or healing done over {$295368d=6 seconds}][]. Each cast of Concentrated Flame deals {$s3=100}% increased damage or healing. This bonus resets after every third cast.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:6376.39
  • base_td_mult:1.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Heed My Call 294 (420) 0.8% (1.1%) 8.2 33.28sec 15353 0 Direct 8.2 9109 18221 10745 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 87908.56 87908.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.71 82.04% 9109.26 8901 9791 9106.69 0 9791 61139 61139 0.00
crit 1.47 17.96% 18221.27 17802 19582 14114.89 0 19582 26769 26769 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 126 0.3% 8.2 33.28sec 4607 0 Direct 8.2 3904 7807 4607 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 37691.95 37691.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.71 81.98% 3904.17 3815 4196 3903.61 0 4196 26186 26186 0.00
crit 1.47 18.02% 7807.25 7629 8392 6056.11 0 8392 11506 11506 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 4849 13.1% 74.0 3.93sec 19592 14987 Direct 74.0 16599 33168 19592 18.1%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.00 74.00 0.00 0.00 1.3073 0.0000 1449841.38 1449841.38 0.00 14986.52 14986.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.63 81.93% 16598.57 8882 21253 16606.33 16038 17914 1006412 1006412 0.00
crit 13.37 18.07% 33167.58 17765 42507 33181.41 29534 38312 443430 443430 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2431 6.5% 14.0 21.26sec 51768 50167 Direct 14.0 2849 5694 3359 17.9%  
Periodic 219.4 2626 5247 3098 18.0% 98.6%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 219.40 219.40 1.0320 1.3449 726866.53 726866.53 0.00 2348.12 50166.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.52 82.06% 2848.58 2589 3565 2849.95 2621 3190 32821 32821 0.00
crit 2.52 17.94% 5694.01 5177 7129 5326.58 0 7129 14343 14343 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.9 81.99% 2625.78 2 3319 2627.02 2552 2745 472328 472328 0.00
crit 39.5 18.01% 5247.50 13 6638 5249.97 4897 5684 207375 207375 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 787 2.1% 43.8 6.62sec 5378 0 Direct 43.8 4558 9112 5378 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.76 43.76 0.00 0.00 0.0000 0.0000 235308.35 235308.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.88 81.99% 4557.64 4180 5756 4559.28 4244 5124 163514 163514 0.00
crit 7.88 18.01% 9111.65 8360 11513 9109.49 0 11513 71794 71794 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2687 (4265) 7.2% (11.5%) 88.6 3.30sec 14398 15962 Direct 89.1 7644 15282 9016 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.58 89.13 0.00 0.00 0.9021 0.0000 803554.61 803554.61 0.00 15961.84 15961.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.12 82.04% 7644.45 6967 9594 7649.24 7345 8091 558986 558986 0.00
crit 16.00 17.96% 15282.06 13933 19188 15293.60 13933 17124 244569 244569 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1578 4.2% 71.5 4.07sec 6601 0 Direct 71.5 6601 0 6601 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.49 71.49 0.00 0.00 0.0000 0.0000 471908.29 471908.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.49 100.00% 6600.50 5086 14007 6603.35 5775 7649 471908 471908 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 11467 30.8% 59.2 5.07sec 57931 55046 Direct 59.0 49253 98410 58122 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.15 58.96 0.00 0.00 1.0524 0.0000 3426813.15 3426813.15 0.00 55045.67 55045.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.32 81.96% 49253.47 45067 61614 49275.94 46929 51792 2380098 2380098 0.00
crit 10.64 18.04% 98410.05 90135 123227 98470.67 90135 112669 1046715 1046715 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1575 4.2% 12.7 23.58sec 37177 35592 Direct 12.7 2369 4738 2790 17.8%  
Periodic 217.1 1702 3402 2007 18.0% 97.8%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.67 12.67 217.05 217.05 1.0446 1.3481 471053.68 471053.68 0.00 1540.12 35591.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.42 82.23% 2368.62 2231 3073 2369.59 2231 2563 24677 24677 0.00
crit 2.25 17.77% 4737.96 4463 6146 4328.17 0 6146 10671 10671 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.1 82.04% 1702.04 3 2151 1702.84 1649 1780 303090 303090 0.00
crit 39.0 17.96% 3402.11 98 4302 3403.81 3194 3684 132616 132616 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5561 14.9% 85.7 3.23sec 19283 0 Direct 85.7 16354 32708 19282 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.68 85.68 0.00 0.00 0.0000 0.0000 1652072.86 1652072.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.33 82.09% 16354.12 15985 17583 16354.03 15985 17198 1150265 1150265 0.00
crit 15.34 17.91% 32708.02 31970 35167 32705.61 31970 35167 501807 501807 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2705 7.3% 17.7 16.80sec 45759 44587 Direct 17.7 3905 7806 4607 18.0%  
Periodic 218.6 2821 5637 3327 18.0% 98.3%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.67 17.67 218.58 218.58 1.0263 1.3463 808679.61 808679.61 0.00 2588.40 44587.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.49 82.01% 3905.04 3570 4917 3905.94 3655 4255 56599 56599 0.00
crit 3.18 17.99% 7806.33 7141 9834 7536.01 0 9834 24815 24815 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.3 82.02% 2820.81 2 3565 2822.18 2746 2965 505742 505742 0.00
crit 39.3 17.98% 5637.40 21 7129 5639.78 5270 6117 221524 221524 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
crucible of flame
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Berserking 2.0 181.45sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 185.47sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8737 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:crucible of flame
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.0 52.0 45.4sec 5.1sec 92.71% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.79%
  • arcanic_pulsar_2:10.59%
  • arcanic_pulsar_3:11.57%
  • arcanic_pulsar_4:10.60%
  • arcanic_pulsar_5:13.42%
  • arcanic_pulsar_6:9.76%
  • arcanic_pulsar_7:11.00%
  • arcanic_pulsar_8:14.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 192.4sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.4sec 181.4sec 8.13% 8.19% 0.0(0.0) 2.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.1 0.0 38.2sec 38.2sec 25.58% 32.32% 0.0(0.0) 7.9

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.6sec 23.70% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.13% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 31.9 45.2 9.5sec 3.9sec 82.36% 99.73% 2.0(2.0) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.33%
  • lunar_empowerment_2:31.88%
  • lunar_empowerment_3:15.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.5sec 34.0sec 47.60% 0.00% 3.4(47.7) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 23.7 50.2 12.4sec 4.0sec 85.89% 80.37% 0.3(0.3) 0.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.87%
  • solar_empowerment_2:39.88%
  • solar_empowerment_3:18.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.1 44.0 20.3sec 5.1sec 96.82% 92.15% 14.3(14.3) 11.4

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.81%
  • starlord_2:23.08%
  • starlord_3:58.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.6sec 23.61% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.61%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:crucible of flame
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
crucible of flame
starsurge Astral Power 59.2 2366.1 40.0 40.0 1448.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 89.58 716.61 (30.77%) 8.00 0.07 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.44%) 40.00 0.00 0.00%
sunfire Astral Power 17.67 53.02 (2.28%) 3.00 0.00 0.00%
shooting_stars Astral Power 43.76 175.02 (7.52%) 4.00 0.01 0.01%
moonfire Astral Power 14.04 42.12 (1.81%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.67 101.37 (4.35%) 8.00 0.00 0.00%
lunar_strike Astral Power 74.00 887.96 (38.13%) 12.00 0.05 0.01%
natures_balance Astral Power 399.62 199.81 (8.58%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.08 73.01 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.78 7.90
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.36 0.00 83.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data crucible of flame Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data crucible of flame Damage Per Second
Count 7672
Mean 37196.48
Minimum 33798.64
Maximum 41666.49
Spread ( max - min ) 7867.85
Range [ ( max - min ) / 2 * 100% ] 10.58%
Standard Deviation 1166.6466
5th Percentile 35362.22
95th Percentile 39227.23
( 95th Percentile - 5th Percentile ) 3865.01
Mean Distribution
Standard Deviation 13.3194
95.00% Confidence Intervall ( 37170.37 - 37222.58 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3779
0.1 Scale Factor Error with Delta=300 11619
0.05 Scale Factor Error with Delta=300 46476
0.01 Scale Factor Error with Delta=300 1161883
Priority Target DPS
Sample Data crucible of flame Priority Target Damage Per Second
Count 7672
Mean 37196.48
Minimum 33798.64
Maximum 41666.49
Spread ( max - min ) 7867.85
Range [ ( max - min ) / 2 * 100% ] 10.58%
Standard Deviation 1166.6466
5th Percentile 35362.22
95th Percentile 39227.23
( 95th Percentile - 5th Percentile ) 3865.01
Mean Distribution
Standard Deviation 13.3194
95.00% Confidence Intervall ( 37170.37 - 37222.58 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3779
0.1 Scale Factor Error with Delta=300 11619
0.05 Scale Factor Error with Delta=300 46476
0.01 Scale Factor Error with Delta=300 1161883
DPS(e)
Sample Data crucible of flame Damage Per Second (Effective)
Count 7672
Mean 37196.48
Minimum 33798.64
Maximum 41666.49
Spread ( max - min ) 7867.85
Range [ ( max - min ) / 2 * 100% ] 10.58%
Damage
Sample Data crucible of flame Damage
Count 7672
Mean 11109549.07
Minimum 8596051.04
Maximum 13665289.90
Spread ( max - min ) 5069238.86
Range [ ( max - min ) / 2 * 100% ] 22.81%
DTPS
Sample Data crucible of flame Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data crucible of flame Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data crucible of flame Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data crucible of flame Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data crucible of flame Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data crucible of flame Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data crucible of flameTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data crucible of flame Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
H 11.47 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.73 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 59.15 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.93 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.59 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.45 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.45 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.67 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 74.36 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 88.82 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.29 sunfire

Sample Sequence

0123456789ACDHHKONPIFGKRQKRQKRQRKRQNRQORQRKPKRLQKQRQHQRRRKRKRQRQRJKKNOQPQKRQKRQQRRHRKNOKQRQKPRQRQRRNRJKRKRKRQOHQKQPQNRRRRKKQOQKRQRRKNQRPHRRKQRGRKRQKRQMNKQQRRRQPKKRQQRHKNOQRKRQRRQKQPKQNRORKRQKRQHRQRKQNRRIEFKPKRORKRQRQRQRSKRKRQHKQQPORRRQRJKNKRKRQQKQQRKQOHNPRKQRGQKRQRKQRRKQQRK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask crucible of flame 58.0/100: 58% astral_power
Pre precombat 1 food crucible of flame 58.0/100: 58% astral_power
Pre precombat 2 augmentation crucible of flame 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H concentrated_flame Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.250 default H concentrated_flame Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, battle_potion_of_intellect
0:02.212 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, lunar_empowerment, battle_potion_of_intellect
0:03.172 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:04.105 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:05.039 default P stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:05.973 default I celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:06.786 default F berserking Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:06.786 default G use_items Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:06.786 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:07.541 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.295 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.172 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.927 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:10.681 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:11.533 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.288 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.043 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.862 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.616 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.371 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.125 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.915 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.670 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.425 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.181 default O moonfire Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.936 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.692 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.472 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.227 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.981 default P stellar_flare Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.736 default K starsurge Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.490 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.245 default L sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.000 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.909 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(16), conch_of_dark_whispers
0:27.764 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:28.827 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:29.582 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
0:30.652 default H concentrated_flame Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
0:31.496 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
0:32.574 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(10)
0:33.328 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(9)
0:34.083 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(8)
0:34.940 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(8)
0:35.797 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25)
0:36.552 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24)
0:37.306 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23)
0:38.059 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22)
0:38.961 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(22)
0:39.717 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21)
0:40.623 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(20)
0:41.376 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19)
0:41.376 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, overwhelming_power(19)
0:42.389 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18)
0:43.525 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17)
0:44.631 default O moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16)
0:45.742 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(15)
0:47.162 default P stellar_flare Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), conch_of_dark_whispers
0:48.284 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), conch_of_dark_whispers
0:49.718 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), conch_of_dark_whispers
0:50.851 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:51.790 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:53.201 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:54.318 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers
0:55.271 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
0:56.703 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
0:58.140 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
0:59.108 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power, conch_of_dark_whispers
1:00.079 default H concentrated_flame Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
1:01.224 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), starlord(3)
1:02.369 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(5)
1:03.619 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:04.832 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:06.044 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord
1:07.257 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:08.758 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:09.759 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:11.260 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:12.436 default P stellar_flare Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:13.581 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:14.554 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:16.013 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:16.901 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:18.236 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:19.132 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:20.030 default N sunfire Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
1:21.093 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers
1:21.998 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20)
1:21.998 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), overwhelming_power(20)
1:23.159 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
1:23.997 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(18)
1:24.984 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17)
1:25.802 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(16)
1:26.768 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15)
1:27.569 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(14)
1:28.775 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(13)
1:29.868 default H concentrated_flame Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(12)
1:31.102 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(10)
1:32.508 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9)
1:33.615 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8)
1:35.032 default P stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
1:36.152 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5)
1:37.586 default N sunfire Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(4)
1:38.712 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
1:39.673 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2)
1:40.640 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power
1:41.782 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements
1:42.927 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(3), torrent_of_elements
1:44.175 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:45.386 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:46.887 default O moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:48.064 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:49.565 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements
1:50.742 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
1:51.716 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:53.177 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
1:54.068 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(23)
1:54.966 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(23)
1:56.021 default N sunfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21)
1:57.083 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20)
1:58.442 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:59.349 default P stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(18)
2:00.422 default H concentrated_flame Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(17)
2:01.499 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(16)
2:02.419 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(15)
2:03.503 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), overwhelming_power(14)
2:04.687 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(13)
2:06.157 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(11)
2:07.147 default G use_items Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), starlord, overwhelming_power(10)
2:07.147 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), starlord, overwhelming_power(10), ignition_mages_fuse
2:08.270 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), lunar_empowerment, starlord, overwhelming_power(9), ignition_mages_fuse
2:09.396 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(8), ignition_mages_fuse
2:10.209 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(7), ignition_mages_fuse
2:11.431 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(6), ignition_mages_fuse(2)
2:12.355 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(5), ignition_mages_fuse(2)
2:13.123 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(2)
2:14.277 default M moonfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(25), ignition_mages_fuse(2)
2:15.123 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(24), ignition_mages_fuse(2)
2:16.098 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
2:17.042 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(3)
2:18.247 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), ignition_mages_fuse(3)
2:19.456 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
2:20.237 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
2:21.162 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
2:22.089 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(17), ignition_mages_fuse(4)
2:23.271 default P stellar_flare Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(5)
2:24.174 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(2), solar_empowerment, overwhelming_power(15), ignition_mages_fuse(5)
2:25.159 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(14), ignition_mages_fuse(5)
2:26.118 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(13), ignition_mages_fuse(5)
2:26.913 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(13), ignition_mages_fuse(5)
2:28.102 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11)
2:29.544 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(10)
2:30.509 default H concentrated_flame Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(9)
2:31.649 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(8)
2:32.792 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)
2:33.909 default O moonfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
2:35.030 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
2:36.467 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(3)
2:37.428 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(2)
2:38.565 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers
2:39.537 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:40.995 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:41.968 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), conch_of_dark_whispers
2:42.941 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), conch_of_dark_whispers
2:44.398 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
2:45.538 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
2:46.953 default P stellar_flare Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
2:48.072 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
2:49.196 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
2:50.594 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
2:51.695 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
2:52.633 default O moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
2:53.741 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16)
2:54.686 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), starlord(2), torrent_of_elements, overwhelming_power(15)
2:55.801 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14)
2:56.606 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13)
2:57.817 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(12)
2:58.770 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11)
2:59.583 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10)
3:00.807 default H concentrated_flame Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
3:01.718 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
3:02.767 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
3:04.109 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
3:05.010 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
3:06.169 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers
3:07.611 default N sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers
3:08.747 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers
3:09.717 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), starlord, torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers
3:10.862 default I celestial_alignment Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers
3:11.860 default E potion Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers
3:11.860 default F berserking Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:11.860 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:12.769 default P stellar_flare Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
3:13.657 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect
3:14.549 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
3:15.303 default O moonfire Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), battle_potion_of_intellect
3:16.176 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect
3:16.930 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect
3:17.807 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), battle_potion_of_intellect
3:18.561 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(7), battle_potion_of_intellect
3:19.685 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), battle_potion_of_intellect
3:20.572 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:21.704 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:22.595 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:23.737 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power berserking, arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(2), battle_potion_of_intellect
3:24.636 default S sunfire Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power, battle_potion_of_intellect
3:25.629 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(5), celestial_alignment, battle_potion_of_intellect
3:26.716 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:27.611 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, battle_potion_of_intellect
3:28.665 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:29.536 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), battle_potion_of_intellect
3:30.841 default H concentrated_flame Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord(2), battle_potion_of_intellect
3:31.866 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(2), battle_potion_of_intellect
3:33.044 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:34.504 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
3:35.965 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:37.013 default O moonfire Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23)
3:38.068 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(22)
3:38.969 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(22)
3:40.027 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20)
3:41.093 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(25)
3:42.427 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(25)
3:43.474 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(24)
3:43.474 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), overwhelming_power(24)
3:44.620 default N sunfire Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23)
3:45.591 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22)
3:46.565 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21)
3:47.372 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(20)
3:48.323 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19)
3:49.114 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18)
3:50.302 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17)
3:51.674 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25)
3:52.723 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
3:54.062 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
3:55.408 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
3:56.310 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
3:57.376 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19)
3:58.738 default O moonfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
3:59.810 default H concentrated_flame Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
4:01.084 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15)
4:02.169 default P stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
4:03.258 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13)
4:04.185 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), solar_empowerment, torrent_of_elements, overwhelming_power(12)
4:05.379 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(11)
4:06.862 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(10)
4:07.856 default G use_items Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9)
4:07.856 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9), ignition_mages_fuse
4:09.291 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(7), ignition_mages_fuse
4:10.425 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(6), ignition_mages_fuse
4:11.367 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), ignition_mages_fuse
4:12.782 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(4), ignition_mages_fuse(2)
4:13.691 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(3), ignition_mages_fuse(2)
4:14.764 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), ignition_mages_fuse(2)
4:16.099 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
4:16.964 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:17.828 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(3)
4:18.845 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:20.139 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(4)
4:21.298 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(4)
4:22.073 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="crucible of flame"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

focusing iris : 36698 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36698.2 36698.2 25.1 / 0.069% 4290.6 / 11.7% 4301.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.5 8.4 Astral Power 0.00% 60.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 36698
Heed My Call 304 (435) 0.8% (1.2%) 8.5 32.13sec 15366 0 Direct 8.5 9106 18219 10753 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.47 8.47 0.00 0.00 0.0000 0.0000 91025.13 91025.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.94 81.94% 9106.44 8901 9791 9105.13 0 9791 63168 63168 0.00
crit 1.53 18.06% 18218.55 17802 19582 14358.00 0 19582 27858 27858 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 131 0.4% 8.5 32.13sec 4614 0 Direct 8.5 3903 7803 4614 18.2%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.47 8.47 0.00 0.00 0.0000 0.0000 39059.79 39059.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.92 81.78% 3903.31 3815 4196 3902.88 0 4196 27023 27023 0.00
crit 1.54 18.22% 7802.96 7629 8392 6241.36 0 8392 12037 12037 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5280 14.4% 80.7 3.63sec 19569 15557 Direct 80.7 16587 33154 19569 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.69 80.69 0.00 0.00 1.2579 0.0000 1579037.68 1579037.68 0.00 15556.56 15556.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.17 82.00% 16587.34 8882 21253 16593.45 15969 17352 1097587 1097587 0.00
crit 14.52 18.00% 33154.24 17765 42507 33164.94 30050 37776 481450 481450 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2551 7.0% 14.1 21.35sec 53957 55093 Direct 14.1 2855 5703 3365 17.9%  
Periodic 230.4 2633 5260 3103 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.13 14.13 230.42 230.42 0.9794 1.2900 762432.35 762432.35 0.00 2450.86 55093.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.60 82.10% 2854.93 2589 3565 2856.02 2609 3116 33120 33120 0.00
crit 2.53 17.90% 5702.54 5177 7129 5332.17 0 7129 14424 14424 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.2 82.12% 2632.56 2 3319 2633.74 2564 2761 498127 498127 0.00
crit 41.2 17.88% 5260.40 35 6638 5262.33 4848 5766 216761 216761 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 830 2.3% 46.0 6.35sec 5387 0 Direct 46.0 4568 9122 5387 18.0%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.03 46.03 0.00 0.00 0.0000 0.0000 247931.90 247931.90 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.75 82.02% 4567.89 4180 5756 4569.97 4317 4938 172431 172431 0.00
crit 8.28 17.98% 9121.83 8360 11513 9120.87 0 11513 75501 75501 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3007 (4719) 8.2% (12.9%) 99.3 2.96sec 14214 16154 Direct 99.8 7644 15276 9012 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.27 99.78 0.00 0.00 0.8799 0.0000 899214.02 899214.02 0.00 16154.39 16154.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.88 82.07% 7643.75 6967 9594 7648.31 7383 8033 625887 625887 0.00
crit 17.89 17.93% 15275.51 13933 19188 15282.96 13933 16818 273327 273327 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1712 4.7% 77.5 3.78sec 6605 0 Direct 77.5 6605 0 6605 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.51 77.51 0.00 0.00 0.0000 0.0000 511903.86 511903.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.51 100.00% 6604.71 5086 14007 6607.70 5793 7832 511904 511904 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 12335 33.6% 63.7 4.74sec 57873 56991 Direct 63.5 49280 98497 58061 17.8%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.70 63.50 0.00 0.00 1.0155 0.0000 3686714.63 3686714.63 0.00 56991.37 56991.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.17 82.16% 49279.80 45067 61614 49300.51 47501 51626 2570937 2570937 0.00
crit 11.33 17.84% 98497.18 90135 123227 98529.77 90135 113441 1115777 1115777 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1657 4.5% 12.8 23.56sec 38785 39165 Direct 12.8 2429 4853 2860 17.8%  
Periodic 228.1 1706 3410 2012 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.77 12.77 228.09 228.09 0.9903 1.2919 495396.89 495396.89 0.00 1612.03 39164.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.50 82.22% 2428.63 2231 3073 2430.09 2231 2640 25504 25504 0.00
crit 2.27 17.78% 4853.05 4463 6146 4426.99 0 6146 11023 11023 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 187.2 82.07% 1706.27 13 2151 1707.06 1660 1775 319378 319378 0.00
crit 40.9 17.93% 3410.13 94 4302 3411.51 3213 3737 139492 139492 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6058 16.4% 93.5 3.00sec 19269 0 Direct 93.5 16351 32704 19269 17.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.50 93.50 0.00 0.00 0.0000 0.0000 1801631.82 1801631.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.82 82.16% 16351.36 15985 17583 16350.88 15985 17317 1256104 1256104 0.00
crit 16.68 17.84% 32704.05 31970 35167 32703.64 31970 35021 545528 545528 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2832 7.7% 17.5 17.08sec 48314 48734 Direct 17.5 3913 7820 4616 18.0%  
Periodic 229.7 2828 5651 3334 18.0% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.52 17.52 229.66 229.66 0.9914 1.2902 846697.60 846697.60 0.00 2699.26 48733.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.37 82.00% 3912.97 3570 4917 3914.31 3638 4239 56231 56231 0.00
crit 3.15 18.00% 7820.44 7141 9834 7586.17 0 9834 24668 24668 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 188.4 82.05% 2827.73 2 3565 2829.03 2750 2945 532841 532841 0.00
crit 41.2 17.95% 5650.66 17 7129 5653.03 5287 6165 232957 232957 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.46sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8798 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.5 56.0 42.5sec 4.7sec 93.27% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.54%
  • arcanic_pulsar_2:11.27%
  • arcanic_pulsar_3:11.25%
  • arcanic_pulsar_4:10.79%
  • arcanic_pulsar_5:12.77%
  • arcanic_pulsar_6:11.23%
  • arcanic_pulsar_7:11.43%
  • arcanic_pulsar_8:12.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.5sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.13% 8.36% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 39.4sec 39.4sec 26.55% 32.97% 0.0(0.0) 7.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.2sec 45.8sec 23.49% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Focused Energy 1.0 382.2 0.0sec 0.8sec 100.00% 99.73% 375.2(375.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:33.31

Stack Uptimes

  • focused_energy_3:0.42%
  • focused_energy_4:0.31%
  • focused_energy_5:0.41%
  • focused_energy_6:0.21%
  • focused_energy_7:0.20%
  • focused_energy_8:0.20%
  • focused_energy_9:0.20%
  • focused_energy_10:98.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.28% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.97%
  • ignition_mages_fuse_2:3.91%
  • ignition_mages_fuse_3:3.86%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 36.2 47.6 8.4sec 3.6sec 81.89% 99.77% 2.1(2.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.85%
  • lunar_empowerment_2:31.24%
  • lunar_empowerment_3:14.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.6 63.5sec 32.9sec 49.19% 0.00% 3.6(50.8) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.44%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.52%
  • overwhelming_power_5:1.56%
  • overwhelming_power_6:1.61%
  • overwhelming_power_7:1.66%
  • overwhelming_power_8:1.71%
  • overwhelming_power_9:1.75%
  • overwhelming_power_10:1.81%
  • overwhelming_power_11:1.86%
  • overwhelming_power_12:1.92%
  • overwhelming_power_13:1.98%
  • overwhelming_power_14:2.03%
  • overwhelming_power_15:2.10%
  • overwhelming_power_16:2.16%
  • overwhelming_power_17:2.22%
  • overwhelming_power_18:2.29%
  • overwhelming_power_19:2.36%
  • overwhelming_power_20:2.43%
  • overwhelming_power_21:2.51%
  • overwhelming_power_22:2.59%
  • overwhelming_power_23:2.67%
  • overwhelming_power_24:2.74%
  • overwhelming_power_25:1.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 26.6 53.2 11.2sec 3.8sec 84.80% 77.83% 0.2(0.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.05%
  • solar_empowerment_2:39.26%
  • solar_empowerment_3:16.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 48.4 20.2sec 4.7sec 97.94% 93.17% 18.2(18.2) 11.4

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.40%
  • starlord_2:21.96%
  • starlord_3:62.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.1sec 45.7sec 23.53% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.53%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 63.7 2548.2 40.0 40.0 1446.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 100.27 802.13 (31.95%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.19%) 40.00 0.00 0.00%
sunfire Astral Power 17.52 52.57 (2.09%) 3.00 0.00 0.00%
shooting_stars Astral Power 46.03 184.10 (7.33%) 4.00 0.00 0.00%
moonfire Astral Power 14.13 42.39 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.77 102.18 (4.07%) 8.00 0.00 0.00%
lunar_strike Astral Power 80.69 968.24 (38.57%) 12.00 0.07 0.01%
natures_balance Astral Power 399.62 199.81 (7.96%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.59 79.13 (3.15%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.39 8.51
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.72 0.00 62.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data focusing iris Damage Per Second
Count 7672
Mean 36698.21
Minimum 33420.15
Maximum 40831.52
Spread ( max - min ) 7411.38
Range [ ( max - min ) / 2 * 100% ] 10.10%
Standard Deviation 1123.8238
5th Percentile 34943.69
95th Percentile 38640.44
( 95th Percentile - 5th Percentile ) 3696.76
Mean Distribution
Standard Deviation 12.8305
95.00% Confidence Intervall ( 36673.07 - 36723.36 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3603
0.1 Scale Factor Error with Delta=300 10782
0.05 Scale Factor Error with Delta=300 43127
0.01 Scale Factor Error with Delta=300 1078153
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 7672
Mean 36698.21
Minimum 33420.15
Maximum 40831.52
Spread ( max - min ) 7411.38
Range [ ( max - min ) / 2 * 100% ] 10.10%
Standard Deviation 1123.8238
5th Percentile 34943.69
95th Percentile 38640.44
( 95th Percentile - 5th Percentile ) 3696.76
Mean Distribution
Standard Deviation 12.8305
95.00% Confidence Intervall ( 36673.07 - 36723.36 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3603
0.1 Scale Factor Error with Delta=300 10782
0.05 Scale Factor Error with Delta=300 43127
0.01 Scale Factor Error with Delta=300 1078153
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 7672
Mean 36698.21
Minimum 33420.15
Maximum 40831.52
Spread ( max - min ) 7411.38
Range [ ( max - min ) / 2 * 100% ] 10.10%
Damage
Sample Data focusing iris Damage
Count 7672
Mean 10961045.68
Minimum 8444520.95
Maximum 13358000.26
Spread ( max - min ) 4913479.31
Range [ ( max - min ) / 2 * 100% ] 22.41%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.96 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.98 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 63.70 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.56 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.00 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.72 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.13 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.77 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 81.06 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 99.53 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.25 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQPQJQPJQPQJQPMQNQPQJOJQPKPJQPPQQQJQJQJQPQLPPJPMQJOQPQPJQPQPQIJMNPQJQPJOQPPQQQIJMJQPJLPPQJQPPOQPMJJQPPNQJQPPJQPMQPJOQPJQGQJQPQLPJMPPPQQJJPOPPJQPNJMQPPQPQPJJPPJOQPJQPKJNQPQPQQJPJPQMQHEFJOJNQPQPQPQIJQJQPJMQPJQPQPJLOPQPQJQMPJQPQJQPQPJNOQPMJQPGJQPPPJQPQJQPKPQQJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, focused_energy(3), battle_potion_of_intellect
0:01.234 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.157 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.075 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:03.990 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:04.779 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(8), conch_of_dark_whispers, battle_potion_of_intellect
0:04.779 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(8), conch_of_dark_whispers, battle_potion_of_intellect
0:04.779 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, focused_energy(8), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:05.533 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), focused_energy(9), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:06.287 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:07.130 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:07.886 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.639 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.395 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.183 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.939 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.694 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.485 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.240 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.995 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.749 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.511 default M sunfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.265 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.019 default N moonfire Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.772 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.526 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.280 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.034 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.789 default O stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.542 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.296 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.050 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
0:23.808 default K sunfire Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.562 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.435 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
0:26.254 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
0:27.006 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
0:28.027 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10)
0:29.052 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(14), focused_energy(10)
0:29.807 default Q solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), focused_energy(10)
0:30.562 default Q solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(13), focused_energy(10)
0:31.373 default J starsurge Fluffy_Pillow 93.5/100: 94% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
0:32.184 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10)
0:32.941 default J starsurge Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10)
0:33.697 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
0:34.452 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), focused_energy(10)
0:35.206 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10)
0:35.961 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10)
0:36.875 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), focused_energy(10)
0:37.631 default L moonfire Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), focused_energy(10)
0:38.386 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), focused_energy(10)
0:39.446 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4), focused_energy(10)
0:40.509 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, torrent_of_elements, overwhelming_power(3), focused_energy(10)
0:41.421 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(2), focused_energy(10)
0:42.895 default M sunfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power, focused_energy(10)
0:44.056 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord, torrent_of_elements, focused_energy(10)
0:45.045 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, focused_energy(10)
0:46.209 default O stellar_flare Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10)
0:47.343 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10)
0:48.304 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
0:49.749 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10)
0:50.712 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
0:52.155 default J starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
0:53.288 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10)
0:54.223 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
0:55.626 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10)
0:56.562 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
0:57.962 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
0:58.901 default I cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
0:58.901 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, torrent_of_elements, focused_energy(10)
1:00.101 default M sunfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10)
1:01.266 default N moonfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10)
1:02.432 default P lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10)
1:03.916 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, focused_energy(10)
1:04.907 default J starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
1:06.073 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10)
1:07.035 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:08.478 default J starsurge Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
1:09.611 default O stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
1:10.712 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
1:11.647 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:13.050 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:14.452 default Q solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), focused_energy(10)
1:15.390 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), focused_energy(10)
1:16.325 default Q solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:17.426 default I cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
1:17.426 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), focused_energy(10)
1:18.625 default M sunfire Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:19.640 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
1:20.654 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
1:21.491 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10)
1:22.745 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10)
1:23.730 default L moonfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:24.688 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:26.091 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:27.495 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3), focused_energy(10)
1:28.431 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:29.533 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10)
1:30.469 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:31.872 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:33.273 default O stellar_flare Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:34.374 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:35.310 default P lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
1:36.713 default M sunfire Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10)
1:37.815 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar(3), solar_empowerment, torrent_of_elements, focused_energy(10)
1:39.014 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, focused_energy(10)
1:40.177 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10)
1:41.139 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
1:42.583 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
1:44.024 default N moonfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10)
1:45.154 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, focused_energy(10)
1:46.116 default J starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, focused_energy(10)
1:47.249 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10)
1:48.185 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:49.587 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:50.990 default J starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:52.091 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10)
1:53.026 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10)
1:54.428 default M sunfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10)
1:55.529 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, focused_energy(10)
1:56.464 default P lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
1:57.867 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), focused_energy(10)
1:59.064 default O stellar_flare Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord, focused_energy(10)
2:00.227 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord, focused_energy(10)
2:01.217 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, focused_energy(10)
2:02.699 default J starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
2:03.864 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10)
2:04.702 default G use_items Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
2:04.702 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse
2:05.507 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(25), focused_energy(10), ignition_mages_fuse
2:06.378 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), ignition_mages_fuse
2:07.133 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10), ignition_mages_fuse
2:08.219 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10), ignition_mages_fuse
2:08.974 default L moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22), focused_energy(10), ignition_mages_fuse(2)
2:09.799 default P lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, lunar_empowerment(3), starlord(3), overwhelming_power(21), focused_energy(10), ignition_mages_fuse(2)
2:11.011 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10), ignition_mages_fuse(2)
2:11.967 default M sunfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), ignition_mages_fuse(2)
2:12.924 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10), ignition_mages_fuse(3)
2:14.102 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10), ignition_mages_fuse(3)
2:15.291 default P lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), focused_energy(10), ignition_mages_fuse(3)
2:16.485 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(14), focused_energy(10), ignition_mages_fuse(3)
2:17.282 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(13), focused_energy(10), ignition_mages_fuse(4)
2:18.055 default J starsurge Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(12), focused_energy(10), ignition_mages_fuse(4)
2:19.049 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11), focused_energy(10), ignition_mages_fuse(4)
2:20.020 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(10), focused_energy(10), ignition_mages_fuse(4)
2:21.222 default O stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), focused_energy(10), ignition_mages_fuse(5)
2:22.137 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8), focused_energy(10), ignition_mages_fuse(5)
2:23.307 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), focused_energy(10), ignition_mages_fuse(5)
2:24.480 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(6), focused_energy(10), ignition_mages_fuse(5)
2:25.404 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5), focused_energy(10)
2:26.324 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10)
2:27.706 default N moonfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), focused_energy(10)
2:28.796 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), focused_energy(10)
2:29.888 default M sunfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power, focused_energy(10)
2:30.984 default Q solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
2:31.920 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
2:33.323 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
2:34.725 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), focused_energy(10)
2:35.661 default P lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
2:37.064 default Q solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), focused_energy(10)
2:38.000 default P lunar_strike Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), focused_energy(10)
2:39.404 default J starsurge Fluffy_Pillow 98.0/100: 98% astral_power arcanic_pulsar(6), focused_energy(10)
2:40.603 default J starsurge Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), focused_energy(10)
2:41.672 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10)
2:43.000 default P lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), focused_energy(10)
2:44.341 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
2:45.395 default O stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
2:46.293 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
2:47.058 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
2:48.206 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
2:49.114 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
2:49.869 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
2:50.993 default K sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
2:51.878 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
2:52.896 default N moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
2:53.921 default Q solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
2:54.793 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
2:56.105 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
2:56.986 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
2:58.306 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
2:59.194 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
3:00.242 default J starsurge Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(13), focused_energy(10), conch_of_dark_whispers
3:01.388 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
3:02.811 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
3:03.931 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(10), focused_energy(10)
3:05.322 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8), focused_energy(10)
3:06.256 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(7), focused_energy(10)
3:07.360 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(6), focused_energy(10)
3:08.304 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(5), focused_energy(10)
3:09.273 default E potion Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4), focused_energy(10)
3:09.273 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4), focused_energy(10), battle_potion_of_intellect
3:09.273 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4), focused_energy(10), battle_potion_of_intellect
3:10.155 default O stellar_flare Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), focused_energy(10), battle_potion_of_intellect
3:11.017 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), focused_energy(10), battle_potion_of_intellect
3:11.882 default N moonfire Fluffy_Pillow 12.5/100: 13% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2), focused_energy(10), battle_potion_of_intellect
3:12.745 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, focused_energy(10), battle_potion_of_intellect
3:13.499 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:14.610 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:15.364 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:16.475 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:17.347 default P lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:18.456 default Q solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power berserking, arcanic_pulsar(6), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:19.211 default I cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:19.211 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:20.159 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:20.941 default J starsurge Fluffy_Pillow 65.5/100: 66% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, focused_energy(10), battle_potion_of_intellect
3:21.863 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect
3:22.700 default P lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(2), focused_energy(10), battle_potion_of_intellect
3:23.955 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(2), focused_energy(10), battle_potion_of_intellect
3:24.940 default M sunfire Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:25.900 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:26.714 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment(3), starlord(3), focused_energy(10), battle_potion_of_intellect
3:27.934 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:28.891 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:29.705 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), focused_energy(10), battle_potion_of_intellect
3:30.923 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:31.882 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), focused_energy(10), battle_potion_of_intellect
3:33.102 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:34.061 default L moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:35.020 default O stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10)
3:36.121 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
3:37.411 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
3:38.277 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
3:39.578 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers
3:40.512 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
3:41.618 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
3:42.535 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
3:43.615 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
3:44.994 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
3:46.081 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
3:46.986 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
3:48.338 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
3:49.248 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
3:50.320 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
3:51.209 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13), focused_energy(10)
3:52.549 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), focused_energy(10)
3:53.446 default P lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), focused_energy(10)
3:54.792 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), focused_energy(10)
3:55.855 default N moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), focused_energy(10)
3:56.921 default O stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), focused_energy(10)
3:57.991 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), focused_energy(10)
3:58.903 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers
4:00.277 default M sunfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10), conch_of_dark_whispers
4:01.362 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), overwhelming_power(3), focused_energy(10), conch_of_dark_whispers
4:02.549 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(2), focused_energy(10), conch_of_dark_whispers
4:03.531 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power, focused_energy(10), conch_of_dark_whispers
4:05.009 default G use_items Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), conch_of_dark_whispers
4:05.009 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:06.128 default Q solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:07.054 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:08.439 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:09.825 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:11.157 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.204 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.959 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.087 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:14.841 default J starsurge Fluffy_Pillow 60.5/100: 61% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.694 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.449 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.535 default K sunfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:18.359 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.565 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.370 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.176 default J starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:22.092 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

life-force : 38414 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
38413.7 38413.7 29.5 / 0.077% 5044.9 / 13.1% 4489.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.2 8.0 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
life-force 38414
Azerite Spike 721 1.9% 16.5 17.45sec 13111 0 Direct 16.4 11145 22295 13126 17.8%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.45 16.43 0.00 0.00 0.0000 0.0000 215692.95 215692.95 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.51 82.24% 11145.12 10657 12308 11141.12 10716 11935 150614 150614 0.00
crit 2.92 17.76% 22294.92 21313 24617 21209.14 0 24617 65079 65079 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295835
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:90.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295835
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:{$@spelldesc295834=Your spells and abilities have a high chance to impale your target with a spike of Azerite, causing ${$m1*(1+$@versadmg)} Fire damage.$?a295837[ When an Azerite spike deals damage, all damage you deal against that target is increased by {$295838s1=5}% for {$295838d=6 seconds}.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9704.69
  • base_dd_max:9704.69
  • base_dd_mult:1.00
 
Heed My Call 301 (430) 0.8% (1.1%) 8.2 33.23sec 15708 0 Direct 8.2 9317 18626 11001 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 89979.29 89979.29 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.91% 9317.02 8901 10280 9315.21 0 10280 62416 62416 0.00
crit 1.48 18.09% 18626.42 17802 20561 14467.53 0 20561 27563 27563 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.3% 8.2 33.23sec 4706 0 Direct 8.2 3992 7989 4706 17.9%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 38492.76 38492.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 82.14% 3992.31 3815 4406 3991.72 0 4406 26820 26820 0.00
crit 1.46 17.86% 7989.12 7629 8812 6192.77 0 8812 11673 11673 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5156 13.4% 77.0 3.79sec 20017 15268 Direct 77.0 16966 33907 20018 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.01 77.01 0.00 0.00 1.3111 0.0000 1541577.64 1541577.64 0.00 15268.13 15268.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.14 81.99% 16965.76 8882 22316 16975.89 16319 17910 1071203 1071203 0.00
crit 13.87 18.01% 33906.64 17765 44632 33925.53 29816 38749 470375 470375 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2506 6.5% 14.0 21.38sec 53473 52568 Direct 14.0 2923 5847 3448 18.0%  
Periodic 220.5 2694 5388 3177 17.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.01 14.01 220.52 220.52 1.0173 1.3430 748985.20 748985.20 0.00 2412.89 52567.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.49 82.03% 2922.73 2589 3743 2924.92 2663 3197 33581 33581 0.00
crit 2.52 17.97% 5847.13 5177 7486 5482.66 0 7486 14718 14718 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.0 82.07% 2694.42 2 3485 2696.05 2613 2815 487622 487622 0.00
crit 39.5 17.93% 5387.85 5 6970 5390.88 4979 5949 213063 213063 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 812 2.1% 44.0 6.63sec 5513 0 Direct 44.0 4676 9348 5513 17.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.03 44.03 0.00 0.00 0.0000 0.0000 242734.28 242734.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.14 82.09% 4676.28 4180 6044 4678.96 4316 5115 169001 169001 0.00
crit 7.89 17.91% 9347.99 8360 12088 9346.06 0 12088 73733 73733 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2885 (4560) 7.5% (11.9%) 93.0 3.15sec 14648 16214 Direct 93.6 7821 15626 9218 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.04 93.56 0.00 0.00 0.9034 0.0000 862345.80 862345.80 0.00 16214.03 16214.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.82 82.11% 7820.95 6967 10073 7826.84 7508 8286 600777 600777 0.00
crit 16.74 17.89% 15626.26 13933 20147 15637.14 14082 18148 261569 261569 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1675 4.4% 74.1 3.93sec 6755 0 Direct 74.1 6755 0 6755 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.10 74.10 0.00 0.00 0.0000 0.0000 500540.78 500540.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.10 100.00% 6755.49 5086 14707 6760.39 5884 8058 500541 500541 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 12114 31.6% 61.1 4.93sec 59285 56407 Direct 60.9 50465 100795 59471 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.07 60.88 0.00 0.00 1.0510 0.0000 3620280.29 3620280.29 0.00 56407.35 56407.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.98 82.11% 50464.55 45067 64694 50493.55 48492 53506 2522388 2522388 0.00
crit 10.89 17.89% 100795.37 90135 129389 100864.62 90135 119575 1097893 1097893 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1627 4.2% 12.7 23.57sec 38229 37043 Direct 12.7 2474 4938 2914 17.9%  
Periodic 218.2 1746 3489 2059 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.72 12.72 218.18 218.18 1.0321 1.3457 486219.87 486219.87 0.00 1585.21 37042.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.45 82.12% 2474.08 2231 3227 2475.19 2269 2740 25842 25842 0.00
crit 2.27 17.88% 4937.92 4463 6453 4536.85 0 6453 11226 11226 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.0 82.05% 1745.58 3 2259 1746.64 1694 1827 312466 312466 0.00
crit 39.2 17.95% 3489.30 120 4517 3491.31 3261 3802 136686 136686 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6005 15.6% 89.4 3.10sec 19965 0 Direct 89.4 16928 33844 19965 18.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.44 89.44 0.00 0.00 0.0000 0.0000 1785550.58 1785550.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.38 82.05% 16928.03 15985 18463 16928.90 16404 17903 1242188 1242188 0.00
crit 16.06 17.95% 33843.63 31970 36925 33848.72 32369 36296 543363 543363 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2791 7.3% 17.9 16.63sec 46580 45418 Direct 17.9 4017 8025 4736 17.9%  
Periodic 219.7 2894 5783 3412 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.91 17.91 219.69 219.69 1.0256 1.3440 834417.02 834417.02 0.00 2660.40 45417.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.70 82.07% 4017.19 3570 5163 4018.29 3701 4418 59063 59063 0.00
crit 3.21 17.93% 8025.18 7141 10325 7778.57 0 10325 25770 25770 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.3 82.06% 2893.56 2 3743 2895.28 2807 3039 521630 521630 0.00
crit 39.4 17.94% 5783.05 17 7486 5786.62 5318 6413 227954 227954 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
pet - guardian_of_azeroth 8325 / 1691
Azerite Spike 7303 3.8% 53.8 3.94sec 8145 7426 Direct 53.8 6927 13853 8145 17.6%  

Stats details: azerite_spike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.80 53.80 0.00 0.00 1.0969 0.0000 438209.70 438209.70 0.00 7425.90 7425.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 44.33 82.40% 6926.52 6927 6927 6926.52 6927 6927 307057 307057 0.00
crit 9.47 17.60% 13853.04 13853 13853 13853.04 13853 13853 131152 131152 0.00
 
 

Action details: azerite_spike

Static Values
  • id:295856
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:35.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295856
  • name:Azerite Spike
  • school:fire
  • tooltip:
  • description:Strike your target with a shard of Azerite, dealing {$s1=0} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6308.05
  • base_dd_max:6308.05
  • base_dd_mult:1.00
 
Azerite Volley 1022 0.5% 6.0 39.27sec 10218 0 Direct 6.0 8658 17316 10218 18.0%  

Stats details: azerite_volley

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.00 6.00 0.00 0.00 0.0000 0.0000 61307.85 61307.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.92 81.98% 8658.15 8658 8658 8658.15 8658 8658 42590 42590 0.00
crit 1.08 18.02% 17316.29 17316 17316 11957.99 0 17316 18718 18718 0.00
 
 

Action details: azerite_volley

Static Values
  • id:303351
  • school:flamestrike
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:303351
  • name:Azerite Volley
  • school:flamestrike
  • tooltip:
  • description:{$@spelldesc295841=Every $303347t1 sec, the Guardian of Azeroth will launch of volley of Azerite Spikes at the target area, dealing {$s1=2287} damage to all enemies near its target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7884.76
  • base_dd_max:7884.76
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
life-force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.69sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.70sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9100 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:life-force
  • harmful:false
  • if_expr:
 
Guardian of Azeroth 2.0 0.00sec

Stats details: guardian_of_azeroth

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 1.1748 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: guardian_of_azeroth

Static Values
  • id:295840
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:295840
  • name:Guardian of Azeroth
  • school:physical
  • tooltip:
  • description:Call upon Azeroth to summon a Guardian of Azeroth for {$300091d=30 seconds} who impales your target with spikes of Azerite every 2 sec that deal ${$295834m1*(1+$@versadmg)} Fire damage.$?a295841[ Every $303347t1 sec, the Guardian launches a volley of Azerite Spikes at its target, dealing {$295841s1=2287} Fire damage to all nearby enemies.][]$?a295843[ Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.][]
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.7 44.2sec 4.9sec 92.83% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.66%
  • arcanic_pulsar_2:10.48%
  • arcanic_pulsar_3:11.35%
  • arcanic_pulsar_4:10.48%
  • arcanic_pulsar_5:13.65%
  • arcanic_pulsar_6:10.41%
  • arcanic_pulsar_7:10.69%
  • arcanic_pulsar_8:14.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.7sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.13% 7.61% 0.0(0.0) 2.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.4sec 37.4sec 25.91% 32.54% 0.0(0.0) 8.1

Buff details

  • buff initial source:life-force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.4sec 23.64% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Guardian of Azeroth 3.6 50.2 76.8sec 3.9sec 49.82% 0.00% 42.2(42.2) 1.4

Buff details

  • buff initial source:life-force
  • cooldown name:buff_guardian_of_azeroth
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.02
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • guardian_of_azeroth_1:32.07%
  • guardian_of_azeroth_2:0.93%
  • guardian_of_azeroth_3:0.93%
  • guardian_of_azeroth_4:0.86%
  • guardian_of_azeroth_5:15.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295855
  • name:Guardian of Azeroth
  • tooltip:Haste increased by {$s1=2}%.
  • description:{$@spelldesc295843=Each time the Guardian of Azeroth casts a spell, you gain {$295855s1=2}% Haste, stacking up to {$295855u=5} times. This effect ends when the Guardian of Azeroth despawns.}
  • max_stacks:5
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.20% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:life-force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.9 46.0 8.9sec 3.8sec 82.05% 99.71% 1.8(1.8) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.86%
  • lunar_empowerment_2:32.00%
  • lunar_empowerment_3:14.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.8sec 34.0sec 47.57% 0.00% 3.4(47.8) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.36%
  • overwhelming_power_2:1.40%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.49%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.6 51.9 12.0sec 3.9sec 85.52% 79.34% 0.2(0.2) 0.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.99%
  • solar_empowerment_2:39.86%
  • solar_empowerment_3:17.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.9 20.2sec 4.9sec 97.34% 93.32% 15.9(15.9) 11.3

Buff details

  • buff initial source:life-force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.24%
  • starlord_2:22.43%
  • starlord_3:60.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.4sec 45.8sec 23.61% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:life-force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:life-force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:life-force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:life-force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:life-force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:life-force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
life-force
starsurge Astral Power 61.1 2442.6 40.0 40.0 1482.1
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 94.04 752.28 (31.28%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 17.91 53.74 (2.23%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.03 176.11 (7.32%) 4.00 0.00 0.00%
moonfire Astral Power 14.01 42.02 (1.75%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.72 101.75 (4.23%) 8.00 0.00 0.00%
lunar_strike Astral Power 77.01 924.10 (38.42%) 12.00 0.06 0.01%
natures_balance Astral Power 399.62 199.81 (8.31%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.27 75.20 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.03 8.16
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.31 0.00 65.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data life-force Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data life-force Damage Per Second
Count 7672
Mean 38413.73
Minimum 34606.51
Maximum 43109.20
Spread ( max - min ) 8502.69
Range [ ( max - min ) / 2 * 100% ] 11.07%
Standard Deviation 1317.1217
5th Percentile 36356.63
95th Percentile 40661.14
( 95th Percentile - 5th Percentile ) 4304.52
Mean Distribution
Standard Deviation 15.0374
95.00% Confidence Intervall ( 38384.26 - 38443.20 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4517
0.1 Scale Factor Error with Delta=300 14810
0.05 Scale Factor Error with Delta=300 59238
0.01 Scale Factor Error with Delta=300 1480934
Priority Target DPS
Sample Data life-force Priority Target Damage Per Second
Count 7672
Mean 38413.73
Minimum 34606.51
Maximum 43109.20
Spread ( max - min ) 8502.69
Range [ ( max - min ) / 2 * 100% ] 11.07%
Standard Deviation 1317.1217
5th Percentile 36356.63
95th Percentile 40661.14
( 95th Percentile - 5th Percentile ) 4304.52
Mean Distribution
Standard Deviation 15.0374
95.00% Confidence Intervall ( 38384.26 - 38443.20 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 46
0.1% Error 4517
0.1 Scale Factor Error with Delta=300 14810
0.05 Scale Factor Error with Delta=300 59238
0.01 Scale Factor Error with Delta=300 1480934
DPS(e)
Sample Data life-force Damage Per Second (Effective)
Count 7672
Mean 38413.73
Minimum 34606.51
Maximum 43109.20
Spread ( max - min ) 8502.69
Range [ ( max - min ) / 2 * 100% ] 11.07%
Damage
Sample Data life-force Damage
Count 7672
Mean 10966816.47
Minimum 8401587.11
Maximum 13485974.32
Spread ( max - min ) 5084387.20
Range [ ( max - min ) / 2 * 100% ] 23.18%
DTPS
Sample Data life-force Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data life-force Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data life-force Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data life-force Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data life-force Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data life-force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data life-forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data life-force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
H 2.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.97 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.07 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.90 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 3.03 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.64 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 10.97 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.72 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.38 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 93.31 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.38 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRQKRNRQORQRQKPKRLQKQQRRRQRRRKRQKRQRJKKNOQKPRQQKRQRRQRRKKNOQQKPRQRRRRQJKNKRKRMQQKQQRKPQNRKQQRKORQRKQRRNRPRRKQKRGRQKRMQQKNQRRRRRRKKPQQKRQKNORQRRRRQRKKQPRKNRQKRMQRQHQRKIEFRKNRQKPRQKORQKRQRQRQKKNQQKRQKPRQORKQRRNKQRQKQRRRKQOPRNRQKGQKRQRRKQRRRRQKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask life-force 58.0/100: 58% astral_power
Pre precombat 1 food life-force 58.0/100: 58% astral_power
Pre precombat 2 augmentation life-force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H guardian_of_azeroth Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.210 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.142 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:04.074 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, guardian_of_azeroth(2), arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.006 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.819 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.819 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.819 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, guardian_of_azeroth(3), arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:06.573 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, guardian_of_azeroth(4), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:07.329 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.083 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.837 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.690 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse
0:10.445 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.200 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.954 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.716 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.469 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.235 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.990 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.744 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.499 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.254 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.007 default O moonfire Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.765 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.519 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.294 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.049 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.967 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.721 default P stellar_flare Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.477 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), ignition_mages_fuse(5)
0:24.231 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), ignition_mages_fuse(5)
0:24.986 default L sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(19), ignition_mages_fuse(5)
0:25.740 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.642 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(17), conch_of_dark_whispers
0:27.495 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:28.554 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:29.617 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, guardian_of_azeroth(5), arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:30.370 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:31.125 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:31.879 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:32.955 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar(8), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:33.802 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
0:34.653 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
0:35.506 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
0:36.362 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, guardian_of_azeroth, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
0:37.118 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, guardian_of_azeroth, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
0:38.014 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, guardian_of_azeroth, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
0:38.769 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
0:39.524 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
0:40.427 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, guardian_of_azeroth, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
0:41.181 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power guardian_of_azeroth, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(20)
0:41.181 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power guardian_of_azeroth, arcanic_pulsar, celestial_alignment, torrent_of_elements, overwhelming_power(20)
0:42.192 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power guardian_of_azeroth, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(19)
0:43.322 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power guardian_of_azeroth, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18)
0:44.424 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power guardian_of_azeroth, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17)
0:45.531 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power guardian_of_azeroth, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16)
0:46.946 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power guardian_of_azeroth, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15)
0:48.060 default P stellar_flare Fluffy_Pillow 3.0/100: 3% astral_power guardian_of_azeroth, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(13)
0:49.153 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power guardian_of_azeroth, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12)
0:50.085 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power guardian_of_azeroth, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:51.487 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power guardian_of_azeroth, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers
0:52.892 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power guardian_of_azeroth, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(9), conch_of_dark_whispers
0:54.000 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power guardian_of_azeroth, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8), conch_of_dark_whispers
0:54.946 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power guardian_of_azeroth, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:56.368 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power guardian_of_azeroth, arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(5), conch_of_dark_whispers
0:57.325 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power guardian_of_azeroth, arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(4), conch_of_dark_whispers
0:58.283 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power guardian_of_azeroth, arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(3), conch_of_dark_whispers
0:59.725 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power guardian_of_azeroth, arcanic_pulsar(5), starlord(3), overwhelming_power(2), conch_of_dark_whispers
1:00.862 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power guardian_of_azeroth, arcanic_pulsar(5), starlord(3), overwhelming_power, conch_of_dark_whispers
1:02.006 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power guardian_of_azeroth, arcanic_pulsar(5), conch_of_dark_whispers
1:03.253 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power guardian_of_azeroth, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:04.464 default N sunfire Fluffy_Pillow 5.5/100: 6% astral_power guardian_of_azeroth, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:05.644 default O moonfire Fluffy_Pillow 9.5/100: 10% astral_power guardian_of_azeroth, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:06.821 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power guardian_of_azeroth, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:08.320 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power guardian_of_azeroth, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:09.819 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power guardian_of_azeroth, arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:10.997 default P stellar_flare Fluffy_Pillow 4.0/100: 4% astral_power guardian_of_azeroth, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:12.143 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power guardian_of_azeroth, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:13.116 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power guardian_of_azeroth, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:14.577 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power guardian_of_azeroth, arcanic_pulsar(8), solar_empowerment(3), starlord(3)
1:15.551 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power guardian_of_azeroth, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:16.525 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power guardian_of_azeroth, arcanic_pulsar(8), solar_empowerment, starlord(3)
1:17.499 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power guardian_of_azeroth, arcanic_pulsar(8), starlord(3)
1:18.644 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power guardian_of_azeroth, arcanic_pulsar(8), lunar_empowerment, starlord(3)
1:20.103 default J cancel_buff Fluffy_Pillow 94.0/100: 94% astral_power guardian_of_azeroth, arcanic_pulsar(8), starlord(3)
1:20.103 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power guardian_of_azeroth, arcanic_pulsar(8)
1:21.351 default N sunfire Fluffy_Pillow 71.0/100: 71% astral_power guardian_of_azeroth, celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:22.405 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power guardian_of_azeroth, celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:23.462 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:24.336 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:25.360 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power guardian_of_azeroth, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:26.208 default M moonfire Fluffy_Pillow 13.0/100: 13% astral_power guardian_of_azeroth, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:27.204 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power guardian_of_azeroth, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3)
1:28.664 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power guardian_of_azeroth, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24)
1:30.002 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power guardian_of_azeroth, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22)
1:31.058 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21)
1:32.410 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
1:33.767 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:34.675 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(18)
1:35.747 default P stellar_flare Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
1:36.824 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
1:38.200 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(14)
1:39.288 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(13)
1:40.217 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, overwhelming_power(12)
1:41.413 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(11)
1:42.895 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(10)
1:44.382 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord, overwhelming_power(8)
1:45.383 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(7)
1:46.564 default O moonfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(6)
1:47.715 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(5)
1:48.700 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4)
1:50.178 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(2)
1:51.174 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power
1:52.347 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:53.807 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3)
1:54.780 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:55.753 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:56.899 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:57.872 default P stellar_flare Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), starlord(3)
1:59.016 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), starlord(3)
2:00.161 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(7), starlord(3)
2:01.308 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(7)
2:02.556 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:04.101 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord
2:05.314 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:06.185 default G use_items Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
2:06.185 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse
2:07.021 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment(2), starlord(2), ignition_mages_fuse
2:08.273 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, lunar_empowerment, starlord(2), overwhelming_power(25), ignition_mages_fuse
2:09.174 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24), ignition_mages_fuse
2:09.929 default M moonfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse
2:10.809 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(2)
2:12.055 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(21), ignition_mages_fuse(2)
2:13.308 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starlord(3), overwhelming_power(24), ignition_mages_fuse(2)
2:14.284 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24), ignition_mages_fuse(3)
2:15.225 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
2:16.427 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(3)
2:17.232 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(3)
2:18.181 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(3)
2:19.122 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(4)
2:20.035 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(4)
2:20.951 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(4)
2:21.866 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), overwhelming_power(21), ignition_mages_fuse(4)
2:22.868 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), ignition_mages_fuse(5)
2:23.811 default P stellar_flare Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), ignition_mages_fuse(5)
2:24.729 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18), ignition_mages_fuse(5)
2:25.901 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17), ignition_mages_fuse(5)
2:27.078 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15)
2:28.192 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14)
2:29.118 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13)
2:30.508 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
2:31.606 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11)
2:32.706 default O moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(10)
2:33.811 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9)
2:34.754 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8)
2:36.172 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6)
2:37.124 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5)
2:38.081 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(4)
2:39.206 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(3)
2:40.338 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2)
2:41.786 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power
2:42.926 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(6), torrent_of_elements
2:44.174 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
2:45.385 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
2:46.886 default P stellar_flare Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
2:48.064 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
2:49.065 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
2:50.242 default N sunfire Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:51.238 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:52.085 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
2:53.354 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:54.351 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:55.196 default M moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:56.192 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:57.653 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:58.628 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:00.089 default H guardian_of_azeroth Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:01.235 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:02.695 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power guardian_of_azeroth, arcanic_pulsar, solar_empowerment(3), starlord(3), conch_of_dark_whispers
3:03.669 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power guardian_of_azeroth, arcanic_pulsar, solar_empowerment(2), conch_of_dark_whispers
3:04.917 default I celestial_alignment Fluffy_Pillow 45.0/100: 45% astral_power guardian_of_azeroth(2), arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord
3:06.061 default E potion Fluffy_Pillow 86.0/100: 86% astral_power guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord
3:06.061 default F berserking Fluffy_Pillow 86.0/100: 86% astral_power guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, battle_potion_of_intellect
3:06.061 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power berserking, guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, battle_potion_of_intellect
3:06.878 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power berserking, guardian_of_azeroth(3), arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, battle_potion_of_intellect
3:07.836 default N sunfire Fluffy_Pillow 55.0/100: 55% astral_power berserking, guardian_of_azeroth(4), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:08.768 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), battle_potion_of_intellect
3:09.562 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:10.748 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:11.681 default P stellar_flare Fluffy_Pillow 40.5/100: 41% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:12.588 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(25), battle_potion_of_intellect
3:13.342 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:14.399 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect
3:15.232 default O moonfire Fluffy_Pillow 31.0/100: 31% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect
3:16.066 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:16.821 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), battle_potion_of_intellect
3:17.887 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power berserking, guardian_of_azeroth(5), arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:18.727 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:19.514 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:20.698 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:21.490 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:22.683 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:23.483 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:24.684 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power guardian_of_azeroth(5), arcanic_pulsar(6), celestial_alignment, overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:25.677 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power guardian_of_azeroth(5), arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:26.788 default N sunfire Fluffy_Pillow 13.5/100: 14% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:27.872 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:29.258 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power guardian_of_azeroth(5), arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:30.653 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:31.752 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power guardian_of_azeroth, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18), conch_of_dark_whispers
3:32.545 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power guardian_of_azeroth, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
3:33.739 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power guardian_of_azeroth, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(16)
3:34.679 default P stellar_flare Fluffy_Pillow 2.0/100: 2% astral_power guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15)
3:35.621 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(25)
3:36.394 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power guardian_of_azeroth, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
3:37.558 default O moonfire Fluffy_Pillow 32.0/100: 32% astral_power guardian_of_azeroth, arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(23)
3:38.613 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power guardian_of_azeroth, arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(22)
3:39.511 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power guardian_of_azeroth, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(21)
3:40.572 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power guardian_of_azeroth, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
3:41.930 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power guardian_of_azeroth, arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
3:42.840 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power guardian_of_azeroth, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(18)
3:43.752 default N sunfire Fluffy_Pillow 39.0/100: 39% astral_power guardian_of_azeroth, arcanic_pulsar(2), starlord(3), overwhelming_power(17)
3:44.829 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power guardian_of_azeroth, arcanic_pulsar(2), overwhelming_power(16)
3:46.006 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power guardian_of_azeroth, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14)
3:47.473 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power guardian_of_azeroth, arcanic_pulsar(3), solar_empowerment, starlord, overwhelming_power(13)
3:48.455 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power guardian_of_azeroth, arcanic_pulsar(3), lunar_empowerment, starlord, overwhelming_power(12)
3:49.930 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power guardian_of_azeroth, arcanic_pulsar(3), starlord, overwhelming_power(11)
3:51.093 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power guardian_of_azeroth, arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9)
3:52.544 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power guardian_of_azeroth, arcanic_pulsar(4), solar_empowerment, starlord(2), overwhelming_power(8)
3:53.517 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power guardian_of_azeroth, arcanic_pulsar(4), starlord(2), overwhelming_power(7)
3:54.665 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power guardian_of_azeroth, arcanic_pulsar(4), starlord(2), torrent_of_elements, overwhelming_power(6)
3:55.815 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power guardian_of_azeroth, arcanic_pulsar(4), starlord(2), torrent_of_elements, overwhelming_power(5)
3:56.972 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power guardian_of_azeroth, arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(4)
3:58.409 default O moonfire Fluffy_Pillow 19.5/100: 20% astral_power guardian_of_azeroth, arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2)
3:59.546 default P stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power guardian_of_azeroth, arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power
4:00.689 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power guardian_of_azeroth, arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements
4:01.662 default N sunfire Fluffy_Pillow 41.0/100: 41% astral_power guardian_of_azeroth, arcanic_pulsar(5), starlord(3), torrent_of_elements
4:02.809 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power guardian_of_azeroth, arcanic_pulsar(5), starlord(3), torrent_of_elements
4:03.955 default Q lunar_strike Fluffy_Pillow 53.5/100: 54% astral_power guardian_of_azeroth, arcanic_pulsar(5), lunar_empowerment, starlord(3), torrent_of_elements
4:05.414 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power guardian_of_azeroth, arcanic_pulsar(5), torrent_of_elements
4:06.664 default G use_items Fluffy_Pillow 31.0/100: 31% astral_power guardian_of_azeroth, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
4:06.664 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power guardian_of_azeroth, arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, ignition_mages_fuse
4:08.145 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power guardian_of_azeroth, arcanic_pulsar(6), solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse
4:09.307 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power guardian_of_azeroth, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), ignition_mages_fuse
4:10.269 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power guardian_of_azeroth, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
4:11.709 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power guardian_of_azeroth, arcanic_pulsar(7), solar_empowerment(3), starlord(2), ignition_mages_fuse(2)
4:12.632 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power guardian_of_azeroth, arcanic_pulsar(7), solar_empowerment(2), starlord(2), ignition_mages_fuse(2)
4:13.558 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power guardian_of_azeroth, arcanic_pulsar(7), solar_empowerment, starlord(2), ignition_mages_fuse(2)
4:14.643 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power guardian_of_azeroth, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:15.990 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power guardian_of_azeroth, arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
4:16.855 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power guardian_of_azeroth, arcanic_pulsar(8), solar_empowerment, starlord(3), ignition_mages_fuse(3)
4:17.720 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power guardian_of_azeroth, arcanic_pulsar(8), starlord(3), ignition_mages_fuse(3)
4:18.736 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power guardian_of_azeroth, arcanic_pulsar(8), starlord(3), ignition_mages_fuse(4)
4:19.717 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power guardian_of_azeroth, arcanic_pulsar(8), lunar_empowerment, starlord(3), ignition_mages_fuse(4)
4:20.965 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power guardian_of_azeroth, arcanic_pulsar(8), solar_empowerment, starlord(3), ignition_mages_fuse(4)
4:21.944 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power guardian_of_azeroth, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="life-force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

lucid dreams : 38068 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
38068.2 38068.2 27.7 / 0.073% 4844.5 / 12.7% 3943.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.6 9.5 Astral Power 0.00% 59.1 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 38068
Heed My Call 297 (424) 0.8% (1.1%) 8.2 33.14sec 15514 0 Direct 8.2 9201 18410 10856 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.19 8.19 0.00 0.00 0.0000 0.0000 88881.82 88881.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 82.04% 9201.48 8901 10180 9197.87 0 10180 61804 61804 0.00
crit 1.47 17.96% 18410.26 17802 20359 14274.42 0 20359 27078 27078 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 127 0.3% 8.2 33.14sec 4659 0 Direct 8.2 3944 7887 4659 18.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.19 8.19 0.00 0.00 0.0000 0.0000 38143.82 38143.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.87% 3943.78 3815 4363 3943.65 3815 4363 26436 26436 0.00
crit 1.48 18.13% 7887.47 7629 8725 6169.58 0 8725 11708 11708 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5029 13.2% 76.2 3.83sec 19758 15025 Direct 76.2 16750 33488 19758 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.17 76.17 0.00 0.00 1.3150 0.0000 1504910.42 1504910.42 0.00 15025.06 15025.06
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.48 82.03% 16749.81 8882 22097 16757.27 16198 17640 1046527 1046527 0.00
crit 13.69 17.97% 33488.47 20430 44195 33509.28 30866 38616 458384 458384 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2497 6.6% 14.1 21.25sec 52760 51727 Direct 14.1 2860 5713 3373 18.0%  
Periodic 222.0 2667 5331 3147 18.0% 99.2%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.15 14.15 222.03 222.03 1.0200 1.3375 746362.74 746362.74 0.00 2396.84 51726.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.60 82.02% 2860.12 2589 3706 2861.53 2649 3104 33186 33186 0.00
crit 2.54 17.98% 5713.27 5177 7413 5371.11 0 7413 14532 14532 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.1 82.01% 2667.27 5 3451 2668.57 2586 2812 485670 485670 0.00
crit 40.0 17.99% 5330.99 3 6901 5333.00 4936 5762 212975 212975 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 810 2.1% 44.3 6.57sec 5463 0 Direct 44.3 4627 9245 5463 18.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.29 44.29 0.00 0.00 0.0000 0.0000 241950.20 241950.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.27 81.89% 4626.55 4180 5985 4628.71 4361 5276 167816 167816 0.00
crit 8.02 18.11% 9244.53 8360 11970 9246.05 0 11513 74134 74134 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2589 (4383) 6.8% (11.5%) 84.0 3.48sec 15609 17589 Direct 84.6 7760 15513 9147 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 83.95 84.61 0.00 0.00 0.8874 0.0000 773993.87 773993.87 0.00 17588.50 17588.50
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.47 82.10% 7759.56 6967 9975 7763.91 7473 8130 539043 539043 0.00
crit 15.15 17.90% 15512.63 13933 19950 15523.38 14110 17800 234951 234951 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1794 4.7% 80.1 3.64sec 6697 0 Direct 80.1 6697 0 6697 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.09 80.09 0.00 0.00 0.0000 0.0000 536349.39 536349.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.09 100.00% 6696.61 5086 14563 6700.33 5934 7786 536349 536349 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 14180 37.3% 72.1 4.20sec 58774 56689 Direct 71.8 49997 99912 59014 18.1%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.08 71.79 0.00 0.00 1.0368 0.0000 4236537.55 4236537.55 0.00 56688.98 56688.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.82 81.93% 49996.55 45067 64060 50017.17 48238 52666 2940688 2940688 0.00
crit 12.97 18.07% 99912.15 90135 128121 99940.94 90135 115824 1295849 1295849 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1622 4.3% 12.7 23.58sec 38038 36919 Direct 12.7 2446 4898 2883 17.8%  
Periodic 219.8 1729 3456 2039 17.9% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.75 12.75 219.81 219.81 1.0304 1.3395 484926.48 484926.48 0.00 1576.64 36918.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.48 82.19% 2446.27 2231 3195 2447.25 2267 2699 25631 25631 0.00
crit 2.27 17.81% 4897.97 4463 6390 4486.74 0 6390 11123 11123 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.4 82.06% 1729.08 8 2237 1729.93 1680 1804 311876 311876 0.00
crit 39.4 17.94% 3456.03 6 4473 3457.45 3215 3752 136296 136296 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6353 16.6% 96.7 2.90sec 19545 0 Direct 96.7 16560 33137 19545 18.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.69 96.69 0.00 0.00 0.0000 0.0000 1889710.72 1889710.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.28 82.00% 16560.08 15985 18282 16559.98 16044 17507 1312855 1312855 0.00
crit 17.41 18.00% 33136.95 31970 36563 33135.29 31970 35470 576856 576856 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2770 7.3% 17.4 17.17sec 47567 46641 Direct 17.4 3972 7935 4682 17.9%  
Periodic 221.2 2863 5722 3376 17.9% 98.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.41 17.41 221.17 221.17 1.0199 1.3385 828150.91 828150.91 0.00 2639.20 46640.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.29 82.07% 3972.14 3570 5112 3973.33 3681 4324 56758 56758 0.00
crit 3.12 17.93% 7935.40 7141 10224 7664.07 0 10224 24769 24769 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.5 82.07% 2863.22 2 3706 2864.60 2768 3005 519731 519731 0.00
crit 39.7 17.93% 5721.84 4 7413 5724.55 5311 6230 226893 226893 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 181.89sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 184.86sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8648 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Memory of Lucid Dreams 2.9 123.02sec

Stats details: memory_of_lucid_dreams

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.0149 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: memory_of_lucid_dreams

Static Values
  • id:298357
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
Spelldata
  • id:298357
  • name:Memory of Lucid Dreams
  • school:physical
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 8.4 63.4 37.7sec 4.2sec 92.32% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.85%
  • arcanic_pulsar_2:12.24%
  • arcanic_pulsar_3:11.87%
  • arcanic_pulsar_4:11.21%
  • arcanic_pulsar_5:11.08%
  • arcanic_pulsar_6:11.55%
  • arcanic_pulsar_7:11.71%
  • arcanic_pulsar_8:11.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 191.6sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 181.9sec 181.9sec 8.13% 8.22% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.5sec 37.5sec 28.33% 35.69% 0.0(0.0) 8.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.3sec 23.75% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.13% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 8.3 2.5 34.6sec 26.0sec 25.30% 0.00% 2.5(2.5) 8.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:353.31

Stack Uptimes

  • lucid_dreams_1:25.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 16.1 73.0 18.2sec 3.4sec 93.81% 99.98% 10.8(10.8) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:19.81%
  • lunar_empowerment_2:43.04%
  • lunar_empowerment_3:30.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Memory of Lucid Dreams 2.9 0.0 123.0sec 123.0sec 14.25% 16.56% 0.0(0.0) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_memory_of_lucid_dreams
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:leech_rating
  • amount:0.00

Stack Uptimes

  • memory_of_lucid_dreams_1:14.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298357
  • name:Memory of Lucid Dreams
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.5 64.5sec 33.8sec 47.84% 0.00% 3.5(48.2) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 8.8 78.5 28.8sec 3.5sec 96.66% 94.68% 4.3(4.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:13.00%
  • solar_empowerment_2:47.38%
  • solar_empowerment_3:36.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.7 56.4 19.6sec 4.2sec 98.36% 93.14% 25.2(25.2) 7.5

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.46%
  • starlord_2:21.65%
  • starlord_3:61.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.0sec 45.7sec 23.65% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.65%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 72.1 2883.3 40.0 40.0 1469.4
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 84.95 788.51 (27.67%) 9.28 0.47 0.06%
celestial_alignment Astral Power 2.00 118.28 (4.15%) 59.14 1.72 1.43%
sunfire Astral Power 17.41 58.90 (2.07%) 3.38 0.00 0.00%
shooting_stars Astral Power 44.29 207.06 (7.26%) 4.68 0.24 0.11%
moonfire Astral Power 14.15 47.24 (1.66%) 3.34 0.00 0.00%
stellar_flare Astral Power 12.75 113.01 (3.96%) 8.86 0.04 0.03%
lunar_strike Astral Power 76.17 1010.64 (35.46%) 13.27 6.70 0.66%
lucid_dreams Astral Power 10.84 216.90 (7.61%) 20.00 0.00 0.00%
natures_balance Astral Power 399.62 199.65 (7.00%) 0.50 0.16 0.08%
arcanic_pulsar Astral Power 7.50 89.99 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 9.52 9.63
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 24.82 0.00 89.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data lucid dreams Damage Per Second
Count 7672
Mean 38068.24
Minimum 34551.72
Maximum 43042.83
Spread ( max - min ) 8491.10
Range [ ( max - min ) / 2 * 100% ] 11.15%
Standard Deviation 1238.7358
5th Percentile 36109.89
95th Percentile 40192.09
( 95th Percentile - 5th Percentile ) 4082.21
Mean Distribution
Standard Deviation 14.1424
95.00% Confidence Intervall ( 38040.52 - 38095.96 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4068
0.1 Scale Factor Error with Delta=300 13100
0.05 Scale Factor Error with Delta=300 52397
0.01 Scale Factor Error with Delta=300 1309909
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 7672
Mean 38068.24
Minimum 34551.72
Maximum 43042.83
Spread ( max - min ) 8491.10
Range [ ( max - min ) / 2 * 100% ] 11.15%
Standard Deviation 1238.7358
5th Percentile 36109.89
95th Percentile 40192.09
( 95th Percentile - 5th Percentile ) 4082.21
Mean Distribution
Standard Deviation 14.1424
95.00% Confidence Intervall ( 38040.52 - 38095.96 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 41
0.1% Error 4068
0.1 Scale Factor Error with Delta=300 13100
0.05 Scale Factor Error with Delta=300 52397
0.01 Scale Factor Error with Delta=300 1309909
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 7672
Mean 38068.24
Minimum 34551.72
Maximum 43042.83
Spread ( max - min ) 8491.10
Range [ ( max - min ) / 2 * 100% ] 11.15%
Damage
Sample Data lucid dreams Damage
Count 7672
Mean 11369917.91
Minimum 8694520.04
Maximum 13986767.19
Spread ( max - min ) 5292247.15
Range [ ( max - min ) / 2 * 100% ] 23.27%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
H 2.87 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
0.00 purifying_blast
0.00 ripple_in_space
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
I 2.00 celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 7.31 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 72.08 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.13 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.47 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 13.94 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.68 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.75 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.35 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 84.19 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.34 sunfire

Sample Sequence

0123456789ACDKONPKHIFGKRQKRQKRKRQKNORQJKRQPKRQRKRQKRQKRLQKQQRQRKKORQKPRQKNRQQRRRQKRKRQKMQNPQKRQRQRJKQKORQNRQKRQPRQJKRKRQKRNRKRMQQQRRRRKKPQKNRQGOHKRQRQJKRKRQKNPRQKRQKRQRKOQQRKNRQQKRPQKRQOQRJKNRQKRQKRQIEFKPKRQONRKRQRKRQKRQKRQRKRQLPOKQQRKRQKRQKRQLQRRQKKOPQKRQKGRNHQKRQQJKRKRKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.249 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.183 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.116 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.049 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.983 default H memory_of_lucid_dreams Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:05.891 default I celestial_alignment Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.683 default F berserking Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.683 default G use_items Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.683 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.437 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.191 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.043 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.796 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.551 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.405 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.159 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.914 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.669 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.424 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.243 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.997 default N sunfire Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.753 default O moonfire Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.508 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.264 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:19.019 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.019 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.774 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.528 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.361 default P stellar_flare Fluffy_Pillow 81.5/100: 82% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.117 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.872 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(2), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.626 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16), ignition_mages_fuse(5)
0:24.416 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), ignition_mages_fuse(5)
0:25.171 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(14), ignition_mages_fuse(5)
0:25.926 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14), ignition_mages_fuse(5)
0:26.683 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13)
0:27.614 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12)
0:28.367 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11)
0:29.120 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(10)
0:30.062 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(9)
0:30.817 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(9)
0:31.571 default L sunfire Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(8)
0:32.325 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(7)
0:33.420 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(6)
0:34.282 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5)
0:35.384 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
0:36.490 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3)
0:37.246 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2)
0:38.360 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power
0:39.114 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(4), solar_empowerment
0:40.075 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
0:41.008 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
0:42.185 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
0:43.187 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:44.687 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
0:45.864 default P stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:47.009 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:47.982 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:49.440 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:50.585 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:51.731 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:52.707 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:54.168 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:55.627 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:56.601 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:57.576 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
0:58.549 default Q lunar_strike Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:00.008 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), solar_empowerment, conch_of_dark_whispers
1:01.257 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
1:02.154 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
1:03.207 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:04.078 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
1:05.382 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
1:06.407 default M moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:07.404 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:08.865 default N sunfire Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:10.011 default P stellar_flare Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:11.156 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:12.614 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:13.660 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), conch_of_dark_whispers
1:14.552 default Q lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:15.895 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:16.795 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:18.127 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:19.025 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:19.025 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, overwhelming_power(22), conch_of_dark_whispers
1:20.179 default Q lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(24), conch_of_dark_whispers
1:21.593 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23), conch_of_dark_whispers
1:22.709 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22), conch_of_dark_whispers
1:23.796 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(21)
1:24.725 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20)
1:26.121 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(18)
1:27.224 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(17)
1:28.165 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
1:29.579 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(15)
1:30.694 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14)
1:31.620 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
1:33.013 default P stellar_flare Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11)
1:34.115 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10)
1:35.054 default Q lunar_strike Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
1:36.465 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(8)
1:36.465 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(6), solar_empowerment(3), overwhelming_power(8)
1:37.677 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(7)
1:38.680 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(6)
1:39.865 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(5)
1:40.850 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4)
1:42.327 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2)
1:43.497 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power
1:44.340 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:45.339 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:46.185 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
1:47.179 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
1:48.026 default M moonfire Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:49.024 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3)
1:50.484 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
1:51.943 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3)
1:53.402 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), torrent_of_elements
1:54.376 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements
1:55.350 default R solar_wrath Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements
1:56.322 default R solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power arcanic_pulsar, starlord(3), torrent_of_elements
1:57.468 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power arcanic_pulsar, torrent_of_elements
1:58.716 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:59.929 default P stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
2:01.107 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
2:02.607 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:03.784 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:04.929 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:05.900 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:07.360 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:07.360 default O moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:08.460 default H memory_of_lucid_dreams Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:09.560 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power memory_of_lucid_dreams, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse
2:10.659 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse
2:11.592 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:12.937 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:13.836 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:15.181 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements, ignition_mages_fuse(2)
2:15.181 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), solar_empowerment(3), torrent_of_elements, ignition_mages_fuse(2)
2:16.333 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, ignition_mages_fuse(3)
2:17.247 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, ignition_mages_fuse(3)
2:18.323 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, ignition_mages_fuse(3)
2:19.212 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
2:20.544 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse(4)
2:21.551 default N sunfire Fluffy_Pillow 62.5/100: 63% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
2:22.529 default P stellar_flare Fluffy_Pillow 69.5/100: 70% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
2:23.508 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
2:24.312 default Q lunar_strike Fluffy_Pillow 86.5/100: 87% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
2:25.516 default K starsurge Fluffy_Pillow 99.5/100: 100% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(5)
2:26.392 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(24), ignition_mages_fuse(5)
2:27.148 default Q lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(5)
2:28.125 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22)
2:29.044 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(21)
2:29.831 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21)
2:31.006 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24)
2:31.783 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(24)
2:32.698 default O moonfire Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(23)
2:33.752 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22)
2:35.099 default Q lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
2:36.455 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), overwhelming_power(19), conch_of_dark_whispers
2:37.444 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), overwhelming_power(18), conch_of_dark_whispers
2:38.613 default N sunfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord, overwhelming_power(17), conch_of_dark_whispers
2:39.753 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord, overwhelming_power(16), conch_of_dark_whispers
2:40.727 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(15), conch_of_dark_whispers
2:42.189 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(13), conch_of_dark_whispers
2:43.662 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(12), conch_of_dark_whispers
2:44.821 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(11), conch_of_dark_whispers
2:45.783 default P stellar_flare Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), conch_of_dark_whispers
2:46.919 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), conch_of_dark_whispers
2:48.369 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), conch_of_dark_whispers
2:49.517 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), conch_of_dark_whispers
2:50.471 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5)
2:51.903 default O moonfire Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4)
2:53.031 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2)
2:54.479 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power
2:55.449 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3)
2:55.449 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2)
2:56.697 default N sunfire Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord
2:57.909 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord
2:58.940 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord
3:00.483 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
3:01.697 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2)
3:02.698 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:04.198 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
3:05.376 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:06.352 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:07.811 default I celestial_alignment Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
3:08.807 default E potion Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
3:08.807 default F berserking Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:08.807 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:09.714 default P stellar_flare Fluffy_Pillow 84.5/100: 85% astral_power berserking, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:10.621 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power berserking, lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:11.529 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:12.298 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:13.454 default O moonfire Fluffy_Pillow 75.0/100: 75% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:14.361 default N sunfire Fluffy_Pillow 83.0/100: 83% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:15.269 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), battle_potion_of_intellect
3:16.041 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power berserking, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), battle_potion_of_intellect
3:17.026 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, battle_potion_of_intellect
3:17.841 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, battle_potion_of_intellect
3:19.064 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, battle_potion_of_intellect
3:19.881 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
3:20.840 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:21.712 default Q lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect
3:23.016 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:24.038 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:24.884 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:26.153 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:27.150 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:27.997 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:29.266 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:30.113 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:31.109 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:31.955 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:33.224 default L sunfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:34.219 default P stellar_flare Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3)
3:35.364 default O moonfire Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3)
3:36.511 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment
3:37.760 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord
3:39.305 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord
3:40.851 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements
3:41.881 default K starsurge Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
3:43.092 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
3:44.093 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
3:45.595 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:46.772 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
3:47.618 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:48.887 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
3:49.798 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
3:50.578 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
3:51.744 default L sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
3:52.665 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
3:54.018 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25)
3:54.908 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25)
3:55.800 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(24)
3:57.138 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar, overwhelming_power(22)
3:58.289 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21)
3:59.411 default O moonfire Fluffy_Pillow 25.0/100: 25% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20)
4:00.505 default P stellar_flare Fluffy_Pillow 28.5/100: 28% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19)
4:01.604 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(18)
4:03.009 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
4:04.121 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15)
4:05.044 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
4:06.429 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
4:07.521 default G use_items Fluffy_Pillow 21.5/100: 22% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12)
4:07.521 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), ignition_mages_fuse
4:08.417 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), ignition_mages_fuse
4:09.474 default H memory_of_lucid_dreams Fluffy_Pillow 33.5/100: 34% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10), ignition_mages_fuse
4:10.534 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), ignition_mages_fuse
4:11.891 default K starsurge Fluffy_Pillow 59.0/100: 59% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), ignition_mages_fuse(2)
4:12.920 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(7), ignition_mages_fuse(2)
4:13.798 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(6), ignition_mages_fuse(2)
4:15.117 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), ignition_mages_fuse(2)
4:16.442 default J cancel_buff Fluffy_Pillow 86.0/100: 86% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(3), ignition_mages_fuse(3)
4:16.442 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), solar_empowerment(2), overwhelming_power(3), ignition_mages_fuse(3)
4:17.538 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(2), ignition_mages_fuse(3)
4:18.447 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power, ignition_mages_fuse(3)
4:19.520 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse(3)
4:20.408 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(4)
4:21.416 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power memory_of_lucid_dreams, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
actions+=/celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

purification protocol : 36042 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36041.6 36041.6 25.2 / 0.070% 4387.6 / 12.2% 4459.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 36042
Heed My Call 293 (419) 0.8% (1.2%) 8.2 33.45sec 15317 0 Direct 8.2 9109 18219 10705 17.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 87535.10 87535.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.74 82.47% 9108.77 8901 9791 9108.13 0 9791 61424 61424 0.00
crit 1.43 17.53% 18219.40 17802 19582 13889.76 0 19582 26111 26111 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 126 0.4% 8.2 33.45sec 4612 0 Direct 8.2 3903 7811 4612 18.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 37707.02 37707.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 81.88% 3903.41 3815 4196 3901.32 0 4196 26133 26133 0.00
crit 1.48 18.12% 7811.40 7629 8392 6080.15 0 8392 11574 11574 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 4969 13.8% 75.9 3.85sec 19574 14954 Direct 75.9 16599 33170 19574 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.91 75.91 0.00 0.00 1.3090 0.0000 1485962.85 1485962.85 0.00 14953.99 14953.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.28 82.05% 16599.09 8882 21253 16605.89 16009 17614 1033850 1033850 0.00
crit 13.63 17.95% 33170.34 17765 42507 33182.19 30171 37507 452113 452113 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2443 6.8% 14.0 21.32sec 52011 50910 Direct 14.0 2856 5711 3364 17.8%  
Periodic 220.4 2629 5253 3100 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 220.35 220.35 1.0217 1.3440 730405.06 730405.06 0.00 2352.44 50909.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 82.19% 2856.09 2589 3565 2857.86 2614 3123 32966 32966 0.00
crit 2.50 17.81% 5710.55 5177 7129 5339.69 0 7129 14281 14281 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.8 82.04% 2628.91 2 3319 2630.13 2556 2746 475216 475216 0.00
crit 39.6 17.96% 5253.09 12 6638 5255.19 4870 5710 207942 207942 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 604 1.7% 16.5 17.46sec 10955 0 Direct 16.5 9295 18599 10955 17.8%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.48 16.48 0.00 0.00 0.0000 0.0000 180579.53 180579.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.54 82.16% 9295.17 9083 9991 9295.40 9083 9862 125887 125887 0.00
crit 2.94 17.84% 18598.62 18166 19983 17699.53 0 19983 54693 54693 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8271.92
  • base_dd_max:8271.92
  • base_dd_mult:1.00
 
Purifying Blast 0 (677) 0.0% (1.9%) 5.5 60.38sec 37013 32255

Stats details: purifying_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 0.00 0.00 0.00 1.1475 0.0000 0.00 0.00 0.00 32254.71 32254.71
 
 

Action details: purifying_blast

Static Values
  • id:295337
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295337
  • name:Purifying Blast
  • school:physical
  • tooltip:
  • description:Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.
 
    Purifying Blast (purifying_tick) 677 1.9% 37.9 7.63sec 5336 0 Periodic 37.9 4534 9069 5336 17.7% 0.0%

Stats details: purifying_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.89 0.00 0.00 37.89 0.0000 0.0000 202204.78 202204.78 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.2 82.31% 4534.17 4441 4885 4533.83 4441 4801 141420 141420 0.00
crit 6.7 17.69% 9069.45 8881 9769 9058.30 0 9769 60785 60785 0.00
 
 

Action details: purifying_tick

Static Values
  • id:295338
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295338
  • name:Purifying Blast
  • school:fire
  • tooltip:
  • description:{$@spelldesc295337=Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4043.71
  • base_dd_max:4043.71
  • base_dd_mult:1.00
 
Shooting Stars 794 2.2% 44.0 6.58sec 5386 0 Direct 44.0 4562 9119 5386 18.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.04 44.04 0.00 0.00 0.0000 0.0000 237190.13 237190.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.08 81.93% 4562.34 4180 5756 4564.19 4285 4957 164627 164627 0.00
crit 7.96 18.07% 9119.10 8360 11513 9115.94 0 10672 72563 72563 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2767 (4383) 7.7% (12.2%) 91.2 3.21sec 14364 15940 Direct 91.8 7644 15278 9014 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.24 91.77 0.00 0.00 0.9011 0.0000 827215.27 827215.27 0.00 15939.59 15939.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.30 82.06% 7644.23 6967 9594 7648.73 7380 8070 575632 575632 0.00
crit 16.47 17.94% 15278.42 13933 19188 15288.77 13933 17387 251583 251583 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1617 4.5% 73.2 3.99sec 6602 0 Direct 73.2 6602 0 6602 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.22 73.22 0.00 0.00 0.0000 0.0000 483386.01 483386.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.22 100.00% 6602.01 5086 14007 6605.22 5761 7793 483386 483386 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 11694 32.5% 60.4 4.99sec 57909 55105 Direct 60.2 49268 98419 58094 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.35 60.16 0.00 0.00 1.0509 0.0000 3495037.29 3495037.29 0.00 55105.04 55105.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.36 82.05% 49268.34 45067 61614 49291.25 47438 51695 2431895 2431895 0.00
crit 10.80 17.95% 98419.46 90135 123227 98447.06 90135 118334 1063142 1063142 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1585 4.4% 12.7 23.57sec 37263 35877 Direct 12.7 2397 4790 2825 17.9%  
Periodic 218.0 1704 3404 2009 17.9% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.72 12.72 218.02 218.02 1.0386 1.3466 473897.48 473897.48 0.00 1544.63 35876.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 82.10% 2396.95 2231 3073 2397.94 2231 2606 25028 25028 0.00
crit 2.28 17.90% 4790.11 4463 6146 4379.41 0 6146 10903 10903 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.9 82.06% 1703.77 2 2151 1704.56 1656 1783 304806 304806 0.00
crit 39.1 17.94% 3404.18 29 4302 3405.56 3202 3730 133160 133160 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5753 15.9% 88.7 3.12sec 19284 0 Direct 88.7 16355 32704 19284 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.69 88.69 0.00 0.00 0.0000 0.0000 1710233.24 1710233.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.80 82.09% 16354.99 15985 17583 16354.78 15985 17496 1190635 1190635 0.00
crit 15.89 17.91% 32704.42 31970 35167 32704.57 31970 35167 519598 519598 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2721 7.6% 17.9 16.62sec 45397 44226 Direct 17.9 3914 7835 4613 17.8%  
Periodic 219.5 2823 5643 3329 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.92 17.92 219.51 219.51 1.0265 1.3450 813312.69 813312.69 0.00 2593.22 44225.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.73 82.19% 3914.33 3570 4917 3914.95 3671 4272 57638 57638 0.00
crit 3.19 17.81% 7834.99 7141 9834 7553.00 0 9834 24999 24999 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.2 82.08% 2823.41 3 3565 2824.73 2746 2973 508703 508703 0.00
crit 39.3 17.92% 5642.89 36 7129 5645.04 5272 6127 221973 221973 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.49sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.08sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9052 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.0 44.7sec 5.0sec 92.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.36%
  • arcanic_pulsar_2:10.29%
  • arcanic_pulsar_3:11.26%
  • arcanic_pulsar_4:10.67%
  • arcanic_pulsar_5:13.72%
  • arcanic_pulsar_6:10.37%
  • arcanic_pulsar_7:10.85%
  • arcanic_pulsar_8:14.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.5sec 182.5sec 8.13% 7.70% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.79% 32.55% 0.0(0.0) 8.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.8sec 45.4sec 23.75% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.20% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.6 45.2 9.0sec 3.8sec 81.92% 99.68% 1.8(1.8) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.29%
  • lunar_empowerment_2:31.65%
  • lunar_empowerment_3:13.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.6sec 34.0sec 47.58% 0.00% 3.4(48.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.90%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.3 51.3 12.1sec 4.0sec 85.78% 79.92% 0.3(0.3) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.06%
  • solar_empowerment_2:39.66%
  • solar_empowerment_3:18.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.1 45.2 20.3sec 5.0sec 97.02% 92.05% 15.4(15.4) 11.4

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.90%
  • starlord_2:22.45%
  • starlord_3:59.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.4sec 45.2sec 23.83% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.83%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 60.4 2414.2 40.0 40.0 1447.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.25 737.91 (31.05%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.37%) 40.00 0.00 0.00%
sunfire Astral Power 17.92 53.75 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.04 176.15 (7.41%) 4.00 0.01 0.00%
moonfire Astral Power 14.04 42.13 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.72 101.74 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 75.91 910.91 (38.33%) 12.00 0.05 0.01%
natures_balance Astral Power 399.62 199.80 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.19 74.28 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.00 0.00 75.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data purification protocol Damage Per Second
Count 7672
Mean 36041.65
Minimum 32184.84
Maximum 40461.85
Spread ( max - min ) 8277.01
Range [ ( max - min ) / 2 * 100% ] 11.48%
Standard Deviation 1125.0095
5th Percentile 34274.17
95th Percentile 37975.74
( 95th Percentile - 5th Percentile ) 3701.57
Mean Distribution
Standard Deviation 12.8440
95.00% Confidence Intervall ( 36016.47 - 36066.82 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3743
0.1 Scale Factor Error with Delta=300 10805
0.05 Scale Factor Error with Delta=300 43218
0.01 Scale Factor Error with Delta=300 1080429
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 7672
Mean 36041.65
Minimum 32184.84
Maximum 40461.85
Spread ( max - min ) 8277.01
Range [ ( max - min ) / 2 * 100% ] 11.48%
Standard Deviation 1125.0095
5th Percentile 34274.17
95th Percentile 37975.74
( 95th Percentile - 5th Percentile ) 3701.57
Mean Distribution
Standard Deviation 12.8440
95.00% Confidence Intervall ( 36016.47 - 36066.82 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3743
0.1 Scale Factor Error with Delta=300 10805
0.05 Scale Factor Error with Delta=300 43218
0.01 Scale Factor Error with Delta=300 1080429
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 7672
Mean 36041.65
Minimum 32184.84
Maximum 40461.85
Spread ( max - min ) 8277.01
Range [ ( max - min ) / 2 * 100% ] 11.48%
Damage
Sample Data purification protocol Damage
Count 7672
Mean 10764666.45
Minimum 8466815.27
Maximum 13352558.31
Spread ( max - min ) 4885743.04
Range [ ( max - min ) / 2 * 100% ] 22.69%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
H 5.46 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.78 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.35 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.07 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.75 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.49 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.30 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.72 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.27 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.50 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.35 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQRKRQKRQKRQRKNORQRQKPRKLQQRKRQKRQRQKQRRRRORKKNPQQKRQRKQRQRHNOKQRRKQPQKRQRKRQNQRKOQKQRRRKPQNQRRRQKKOQQRKQRNKRPQHRRRKGRKRQRQKONQQKRQRRRPRRKQKRONQKRQQKRQRRRKPQKNRQKRMQQKHRQQIEFKNRPRQKORQKRQKRQRQRLQKRQRKPROQKRQKRQLQRKRKRQKRQQKOHNPRQGRRRKQKQRQKRQRQKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H purifying_blast Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.251 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, battle_potion_of_intellect
0:02.214 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:03.146 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(25), battle_potion_of_intellect
0:03.997 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(25), battle_potion_of_intellect
0:04.849 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24), battle_potion_of_intellect
0:05.603 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), battle_potion_of_intellect
0:05.603 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), battle_potion_of_intellect
0:05.603 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse
0:06.358 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse
0:07.113 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse
0:07.928 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse
0:08.681 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse
0:09.436 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse
0:10.190 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.947 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.701 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.454 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.215 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.970 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.725 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.482 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.237 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.990 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.745 default O moonfire Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.499 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.252 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.050 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.803 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.603 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.356 default P stellar_flare Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.110 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse(5)
0:23.864 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.619 default L sunfire Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.374 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.302 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8), conch_of_dark_whispers
0:27.424 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(7)
0:28.178 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6)
0:29.065 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5)
0:29.820 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5)
0:30.779 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
0:31.536 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3)
0:32.291 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2)
0:33.260 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power
0:34.016 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
0:34.993 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar, solar_empowerment, starlord(3)
0:35.878 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
0:37.002 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment(2), starlord(3)
0:37.756 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar(2), solar_empowerment, starlord(3)
0:38.511 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(2), starlord(3)
0:39.393 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar(2), starlord(3)
0:40.276 default O moonfire Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar(2), starlord(3)
0:41.159 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(2), starlord(3)
0:42.306 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2)
0:43.555 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord
0:44.766 default N sunfire Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:45.943 default P stellar_flare Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25)
0:47.019 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
0:48.398 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22)
0:49.783 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(21)
0:50.875 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20)
0:51.781 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
0:53.142 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:54.056 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:55.139 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:56.520 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers
0:57.446 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers
0:58.838 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers
0:59.771 default H purifying_blast Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
1:01.105 default N sunfire Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
1:02.213 default O moonfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
1:03.325 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), solar_empowerment, torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
1:04.542 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
1:06.051 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
1:07.066 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
1:08.085 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(2)
1:09.287 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power
1:10.781 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25)
1:11.857 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(24)
1:13.234 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22)
1:14.323 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
1:15.109 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20)
1:16.290 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19)
1:17.081 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18)
1:18.013 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17)
1:18.810 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(17)
1:20.005 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(15)
1:21.087 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(14)
1:22.472 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, starlord(3), overwhelming_power(13)
1:23.564 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, overwhelming_power(12)
1:24.759 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11)
1:25.923 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(10)
1:27.411 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), solar_empowerment, starlord, overwhelming_power(8)
1:28.587 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7)
1:30.050 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(5)
1:31.035 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(4)
1:32.020 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), starlord(2), overwhelming_power(3)
1:33.184 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(2), overwhelming_power(2)
1:34.353 default P stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power
1:35.494 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3)
1:36.953 default N sunfire Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
1:38.100 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3)
1:39.559 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
1:40.533 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(4), starlord(3)
1:41.677 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(4), starlord(3)
1:42.822 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3)
1:44.282 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(4)
1:45.532 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
1:46.744 default O moonfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:47.922 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24)
1:49.298 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22)
1:50.684 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(21)
1:51.612 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(20)
1:52.707 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
1:54.067 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(17)
1:54.983 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(17)
1:56.061 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(15)
1:57.146 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
1:58.072 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13)
1:59.165 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
2:00.561 default H purifying_blast Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(11)
2:01.661 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(24)
2:02.554 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23)
2:03.450 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(22)
2:04.508 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), overwhelming_power(21)
2:05.664 default G use_items Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20)
2:05.664 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20), ignition_mages_fuse
2:06.466 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(19), ignition_mages_fuse
2:07.413 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), ignition_mages_fuse
2:08.201 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(17), ignition_mages_fuse
2:09.380 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(16), ignition_mages_fuse
2:10.171 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(15), ignition_mages_fuse(2)
2:11.314 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, lunar_empowerment, starlord(2), overwhelming_power(14), ignition_mages_fuse(2)
2:12.350 default O moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), ignition_mages_fuse(2)
2:13.361 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12), ignition_mages_fuse(2)
2:14.377 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), ignition_mages_fuse(3)
2:15.627 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(10), ignition_mages_fuse(3)
2:16.878 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(9), ignition_mages_fuse(3)
2:17.866 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8), ignition_mages_fuse(4)
2:18.677 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), ignition_mages_fuse(4)
2:19.897 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(6), ignition_mages_fuse(4)
2:20.715 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(5), ignition_mages_fuse(4)
2:21.536 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(4), ignition_mages_fuse(4)
2:22.505 default P stellar_flare Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(3), ignition_mages_fuse(5)
2:23.442 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(2), ignition_mages_fuse(5)
2:24.384 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power, ignition_mages_fuse(5)
2:25.326 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(3), ignition_mages_fuse(5)
2:26.356 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
2:27.901 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord
2:29.112 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2)
2:30.112 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:31.289 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:32.469 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:33.970 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
2:35.147 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:36.120 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:37.581 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:39.041 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:40.188 default R solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
2:41.161 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
2:42.619 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3)
2:43.592 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:44.564 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
2:45.539 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment, conch_of_dark_whispers
2:46.788 default P stellar_flare Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
2:48.000 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers
2:49.544 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:50.757 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:51.782 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
2:52.652 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
2:53.956 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
2:54.982 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:55.829 default M moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
2:56.826 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
2:58.285 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
2:59.745 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3)
3:00.888 default H purifying_blast Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:02.035 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:03.009 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3)
3:04.468 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:05.928 default I celestial_alignment Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2)
3:07.016 default E potion Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2)
3:07.016 default F berserking Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), battle_potion_of_intellect
3:07.016 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), battle_potion_of_intellect
3:08.002 default N sunfire Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, battle_potion_of_intellect
3:08.962 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord, battle_potion_of_intellect
3:09.778 default P stellar_flare Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, battle_potion_of_intellect
3:10.739 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, battle_potion_of_intellect
3:11.554 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect
3:12.776 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
3:13.738 default O moonfire Fluffy_Pillow 46.0/100: 46% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:14.670 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:15.462 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect
3:16.651 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:17.584 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:18.353 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:19.508 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect
3:20.504 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:21.352 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect
3:22.622 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:23.468 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:24.738 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:25.586 default L sunfire Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:26.582 default Q lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:28.042 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), torrent_of_elements, battle_potion_of_intellect
3:29.291 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord, torrent_of_elements, battle_potion_of_intellect
3:30.322 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, battle_potion_of_intellect
3:31.864 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, battle_potion_of_intellect
3:32.895 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
3:34.107 default P stellar_flare Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
3:35.284 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
3:36.284 default O moonfire Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
3:37.462 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
3:38.962 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
3:40.141 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:40.988 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:42.257 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:43.254 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
3:44.032 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
3:45.200 default L sunfire Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
3:46.120 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
3:47.474 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(20)
3:48.379 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar, solar_empowerment(2), torrent_of_elements, overwhelming_power(19)
3:49.544 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(18)
3:50.508 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(17)
3:51.647 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(16)
3:52.591 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(15)
3:54.011 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13)
3:55.135 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
3:56.030 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
3:57.372 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
3:58.720 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(21)
3:59.782 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20)
4:00.847 default H purifying_blast Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19)
4:01.957 default N sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(24)
4:03.007 default P stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22)
4:04.064 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21)
4:04.965 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
4:06.318 default G use_items Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(19)
4:06.318 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(19), ignition_mages_fuse
4:07.193 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(18), ignition_mages_fuse
4:08.071 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(17), ignition_mages_fuse
4:09.107 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar(5), lunar_empowerment, overwhelming_power(16), ignition_mages_fuse
4:10.240 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(15), ignition_mages_fuse
4:11.644 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), ignition_mages_fuse(2)
4:12.709 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), ignition_mages_fuse(2)
4:13.983 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(24), ignition_mages_fuse(2)
4:14.835 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), ignition_mages_fuse(3)
4:16.070 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(21), ignition_mages_fuse(3)
4:17.046 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20), ignition_mages_fuse(3)
4:17.854 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), ignition_mages_fuse(3)
4:19.067 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
4:19.855 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), ignition_mages_fuse(4)
4:21.035 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(16), ignition_mages_fuse(4)
4:21.967 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16), ignition_mages_fuse(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

ripple in space : 35773 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
35772.8 35772.8 25.1 / 0.070% 4383.0 / 12.3% 4426.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 35773
Heed My Call 293 (418) 0.8% (1.2%) 8.2 33.42sec 15336 0 Direct 8.2 9108 18214 10739 17.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.16 8.16 0.00 0.00 0.0000 0.0000 87593.58 87593.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 82.08% 9108.12 8901 9791 9105.65 0 9791 60973 60973 0.00
crit 1.46 17.92% 18213.59 17802 19582 14069.94 0 19582 26620 26620 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 125 0.4% 8.2 33.42sec 4596 0 Direct 8.2 3903 7811 4596 17.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.16 8.16 0.00 0.00 0.0000 0.0000 37487.05 37487.05 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.71 82.26% 3902.97 3815 4196 3902.45 3815 4196 26184 26184 0.00
crit 1.45 17.74% 7810.56 7629 8392 5988.54 0 8392 11303 11303 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5088 14.2% 75.9 3.84sec 20042 15309 Direct 75.9 16983 33954 20042 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.92 75.92 0.00 0.00 1.3092 0.0000 1521523.59 1521523.59 0.00 15308.77 15308.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.23 81.97% 16983.10 8882 22539 16990.88 16319 17956 1056881 1056881 0.00
crit 13.68 18.03% 33953.56 17765 45078 33969.20 30499 39647 464643 464643 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2504 7.0% 14.1 21.31sec 53264 52105 Direct 14.1 2936 5868 3466 18.1%  
Periodic 220.3 2694 5382 3177 18.0% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.06 14.06 220.31 220.31 1.0223 1.3442 748640.64 748640.64 0.00 2410.96 52104.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.52 81.94% 2936.38 2589 3780 2938.52 2658 3251 33818 33818 0.00
crit 2.54 18.06% 5868.36 5177 7561 5492.53 0 7561 14895 14895 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.7 82.04% 2694.18 3 3520 2695.55 2609 2819 486918 486918 0.00
crit 39.6 17.96% 5381.99 20 7039 5383.98 5006 5897 213009 213009 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Ripple in Space 348 1.0% 5.5 60.36sec 18997 16565 Direct 5.4 19114 0 19114 0.0%  

Stats details: ripple_in_space

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 5.43 0.00 0.00 1.1469 0.0000 103749.37 103749.37 0.00 16565.44 16565.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.43 100.00% 19113.84 18744 20618 19112.92 18744 20306 103749 103749 0.00
 
 

Action details: ripple_in_space

Static Values
  • id:302731
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:302731
  • name:Ripple in Space
  • school:physical
  • tooltip:About to relocate with Ripple in Space.
  • description:Create an Azerite beacon at a target location. After {$d=4 seconds}, the Heart of Azeroth will relocate you to this beacon and deal {$s2=4952} Fire damage to all nearby enemies.$?a302780[ For {$302864d=10 seconds} after being relocated, you take {$302864s1=10}% reduced damage.][]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:17069.54
  • base_dd_max:17069.54
  • base_dd_mult:1.00
 
Shooting Stars 812 2.3% 44.0 6.59sec 5517 0 Direct 44.0 4675 9334 5517 18.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.01 44.01 0.00 0.00 0.0000 0.0000 242817.62 242817.62 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.06 81.93% 4674.96 4180 6104 4677.39 4313 5188 168571 168571 0.00
crit 7.95 18.07% 9333.85 8360 12209 9334.99 0 12209 74247 74247 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2840 (4499) 7.9% (12.6%) 91.2 3.22sec 14751 16367 Direct 91.7 7845 15690 9256 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.18 91.71 0.00 0.00 0.9013 0.0000 848901.53 848901.53 0.00 16367.18 16367.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.21 82.01% 7844.56 6967 10174 7849.51 7553 8396 590004 590004 0.00
crit 16.50 17.99% 15690.13 13933 20348 15701.88 14143 17911 258897 258897 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1659 4.6% 73.2 3.99sec 6780 0 Direct 73.2 6780 0 6780 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.18 73.18 0.00 0.00 0.0000 0.0000 496169.35 496169.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.18 100.00% 6780.06 5086 14854 6783.93 5853 7990 496169 496169 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5085.61
  • base_dd_max:5085.61
  • base_dd_mult:1.00
 
Starsurge 11946 33.4% 60.3 4.99sec 59160 56283 Direct 60.1 50337 100551 59350 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.34 60.15 0.00 0.00 1.0511 0.0000 3569835.56 3569835.56 0.00 56282.59 56282.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.35 82.05% 50337.21 45067 65034 50363.60 48443 53653 2484351 2484351 0.00
crit 10.80 17.95% 100550.95 90135 130068 100599.54 90135 119029 1085485 1085485 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1623 4.5% 12.7 23.57sec 38159 36726 Direct 12.7 2444 4893 2883 17.9%  
Periodic 218.0 1745 3489 2058 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.72 12.72 217.96 217.96 1.0391 1.3470 485291.32 485291.32 0.00 1581.80 36725.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 82.09% 2444.01 2231 3259 2444.70 2263 2694 25515 25515 0.00
crit 2.28 17.91% 4892.51 4463 6518 4473.00 0 6518 11143 11143 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.8 82.04% 1745.27 17 2281 1746.15 1693 1822 312075 312075 0.00
crit 39.1 17.96% 3488.65 65 4562 3490.11 3273 3794 136558 136558 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5747 16.0% 88.6 3.13sec 19274 0 Direct 88.6 16351 32706 19274 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.65 88.65 0.00 0.00 0.0000 0.0000 1708625.59 1708625.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.81 82.13% 16351.35 15985 17583 16351.11 15985 17277 1190487 1190487 0.00
crit 15.84 17.87% 32706.09 31970 35167 32706.05 31970 35167 518138 518138 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2788 7.8% 17.9 16.64sec 46561 45342 Direct 17.9 4018 8025 4737 17.9%  
Periodic 219.5 2893 5780 3411 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.90 17.90 219.45 219.45 1.0269 1.3453 833389.47 833389.47 0.00 2657.36 45342.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.69 82.06% 4018.27 3570 5214 4019.19 3733 4372 59019 59019 0.00
crit 3.21 17.94% 8024.63 7141 10429 7770.72 0 10429 25769 25769 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.1 82.06% 2893.10 2 3780 2894.53 2804 3026 520970 520970 0.00
crit 39.4 17.94% 5780.33 27 7561 5783.11 5327 6283 227632 227632 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.47sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.09sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9047 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.0 44.7sec 5.0sec 92.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.28%
  • arcanic_pulsar_2:10.31%
  • arcanic_pulsar_3:11.29%
  • arcanic_pulsar_4:10.64%
  • arcanic_pulsar_5:13.75%
  • arcanic_pulsar_6:10.34%
  • arcanic_pulsar_7:10.86%
  • arcanic_pulsar_8:14.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.13% 7.80% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.79% 32.54% 0.0(0.0) 8.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.5sec 45.7sec 23.56% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.20% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.3 45.5 9.1sec 3.8sec 81.99% 99.69% 1.9(1.9) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.08%
  • lunar_empowerment_2:31.71%
  • lunar_empowerment_3:14.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 65.0sec 34.4sec 47.27% 0.00% 3.4(46.5) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.36%
  • overwhelming_power_2:1.40%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.56%
  • overwhelming_power_7:1.60%
  • overwhelming_power_8:1.65%
  • overwhelming_power_9:1.70%
  • overwhelming_power_10:1.74%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.90%
  • overwhelming_power_14:1.95%
  • overwhelming_power_15:2.01%
  • overwhelming_power_16:2.07%
  • overwhelming_power_17:2.13%
  • overwhelming_power_18:2.20%
  • overwhelming_power_19:2.26%
  • overwhelming_power_20:2.33%
  • overwhelming_power_21:2.40%
  • overwhelming_power_22:2.47%
  • overwhelming_power_23:2.54%
  • overwhelming_power_24:2.61%
  • overwhelming_power_25:1.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reality Shift 5.4 0.0 60.4sec 60.4sec 35.19% 0.00% 105.1(105.1) 5.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_reality_shift
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:668.07

Stack Uptimes

  • reality_shift_1:35.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302916
  • name:Reality Shift
  • tooltip:
  • description:$?a302961[Your movement speed is increased by {$302961s1=5}%, and when][When] you move more than {$s1=25} yds within {$s4=4} sec, gain {$s2=194} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] for {$302952d=15 seconds}. This can only occur once every {$302953d=30 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.3 51.3 12.1sec 4.0sec 85.73% 79.91% 0.3(0.3) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.04%
  • solar_empowerment_2:39.63%
  • solar_empowerment_3:18.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.2 20.3sec 5.0sec 97.03% 91.99% 15.3(15.3) 11.4

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.93%
  • starlord_2:22.45%
  • starlord_3:59.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.5sec 45.3sec 23.61% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 60.3 2413.7 40.0 40.0 1479.0
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.19 737.42 (31.04%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.37%) 40.00 0.00 0.00%
sunfire Astral Power 17.90 53.70 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.02 176.05 (7.41%) 4.00 0.01 0.01%
moonfire Astral Power 14.06 42.17 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.72 101.74 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 75.92 910.92 (38.34%) 12.00 0.07 0.01%
natures_balance Astral Power 399.62 199.81 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.19 74.24 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.46 0.00 80.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data ripple in space Damage Per Second
Count 7672
Mean 35772.81
Minimum 32477.38
Maximum 39903.05
Spread ( max - min ) 7425.67
Range [ ( max - min ) / 2 * 100% ] 10.38%
Standard Deviation 1120.7349
5th Percentile 33988.21
95th Percentile 37672.11
( 95th Percentile - 5th Percentile ) 3683.89
Mean Distribution
Standard Deviation 12.7952
95.00% Confidence Intervall ( 35747.73 - 35797.89 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3771
0.1 Scale Factor Error with Delta=300 10723
0.05 Scale Factor Error with Delta=300 42890
0.01 Scale Factor Error with Delta=300 1072234
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 7672
Mean 35772.81
Minimum 32477.38
Maximum 39903.05
Spread ( max - min ) 7425.67
Range [ ( max - min ) / 2 * 100% ] 10.38%
Standard Deviation 1120.7349
5th Percentile 33988.21
95th Percentile 37672.11
( 95th Percentile - 5th Percentile ) 3683.89
Mean Distribution
Standard Deviation 12.7952
95.00% Confidence Intervall ( 35747.73 - 35797.89 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3771
0.1 Scale Factor Error with Delta=300 10723
0.05 Scale Factor Error with Delta=300 42890
0.01 Scale Factor Error with Delta=300 1072234
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 7672
Mean 35772.81
Minimum 32477.38
Maximum 39903.05
Spread ( max - min ) 7425.67
Range [ ( max - min ) / 2 * 100% ] 10.38%
Damage
Sample Data ripple in space Damage
Count 7672
Mean 10684024.67
Minimum 8266823.57
Maximum 13271547.92
Spread ( max - min ) 5004724.35
Range [ ( max - min ) / 2 * 100% ] 23.42%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
H 5.46 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.78 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.34 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.05 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.77 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.48 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.29 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.72 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.28 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.44 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.37 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQRKRQKRQNRQORQRKPKRLKQRQQQRRKRKRKRQRMQQKNQKPQRKQRRQKQRHNOKQRRRKPQQKRQKRQLRRKOQRRKQQPKNRQQRRRKOQKQRRQKNQPRHRRRKGQKORQKRQNRKQRRRRPRRQKKQONKRQQKRQRRRRRPKKNQOQRKRQRKHLQRRIEFKRKPRQKORQRQKRQNRQRQMRKKQQKPRQNRRRRRKRQKRQKOQKNPQQHKRQGQRKQOKRNQRKRQRR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H ripple_in_space Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.248 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, battle_potion_of_intellect
0:02.210 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:03.143 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:04.077 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.010 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.821 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.821 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect
0:05.821 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:06.574 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:07.329 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.204 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:08.957 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:09.711 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse
0:10.563 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.318 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.071 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.825 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.646 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.399 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.153 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.941 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.697 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.451 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.240 default O moonfire Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.995 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.751 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.586 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.341 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.094 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.848 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.603 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(5)
0:24.360 default L sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:25.114 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:25.868 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:26.992 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:27.747 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3)
0:28.870 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:29.994 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:31.118 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
0:31.873 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
0:32.627 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements
0:33.508 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
0:34.264 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements
0:35.032 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:35.787 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:36.554 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
0:37.310 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements
0:38.286 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:39.039 default M moonfire Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements
0:39.806 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements
0:40.929 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements
0:42.055 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(2), torrent_of_elements
0:43.303 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
0:44.516 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers
0:46.060 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), solar_empowerment, starlord, conch_of_dark_whispers
0:47.273 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:48.451 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:49.952 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), conch_of_dark_whispers
0:50.953 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), conch_of_dark_whispers
0:52.129 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:53.587 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:54.561 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), conch_of_dark_whispers
0:55.535 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), conch_of_dark_whispers
0:56.994 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), starlord(3), conch_of_dark_whispers
0:58.138 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
0:59.596 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(25)
1:00.487 default H ripple_in_space Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(24)
1:01.538 default N sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(23)
1:02.593 default O moonfire Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, overwhelming_power(22)
1:03.744 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment, overwhelming_power(21)
1:04.898 default Q lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(20)
1:06.334 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord, overwhelming_power(18)
1:07.300 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord, overwhelming_power(17)
1:08.269 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power reality_shift, arcanic_pulsar(7), starlord, overwhelming_power(16)
1:09.413 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, starlord, overwhelming_power(15)
1:10.560 default P stellar_flare Fluffy_Pillow 8.0/100: 8% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(14)
1:11.678 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(13)
1:13.109 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(11)
1:14.550 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(10)
1:15.686 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
1:16.505 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8)
1:17.738 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power reality_shift, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(7)
1:18.710 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
1:19.538 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(5)
1:20.785 default L sunfire Fluffy_Pillow 26.5/100: 27% astral_power reality_shift, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(4)
1:21.766 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(3)
1:22.730 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, starlord(3), overwhelming_power(2)
1:23.868 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, overwhelming_power
1:25.111 default O moonfire Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
1:26.324 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
1:27.867 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), solar_empowerment, starlord
1:28.898 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), starlord
1:30.110 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, starlord
1:31.323 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
1:32.826 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:34.327 default P stellar_flare Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements
1:35.506 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers
1:36.686 default N sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:37.832 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:38.806 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:40.264 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:41.723 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:42.697 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
1:43.670 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:44.816 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(4), torrent_of_elements, conch_of_dark_whispers
1:46.063 default O moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:47.276 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:48.820 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment, starlord, conch_of_dark_whispers
1:50.033 default Q lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:51.533 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2)
1:52.536 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2)
1:53.538 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2)
1:55.039 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2)
1:56.217 default N sunfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:57.362 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:58.824 default P stellar_flare Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:59.970 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:00.943 default H ripple_in_space Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:02.088 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:03.062 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power reality_shift, arcanic_pulsar(7), starlord(3)
2:04.207 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power reality_shift, arcanic_pulsar(7), starlord(3)
2:05.352 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power reality_shift, arcanic_pulsar(7)
2:06.601 default G use_items Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:06.601 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, ignition_mages_fuse
2:08.083 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord, ignition_mages_fuse
2:09.244 default O moonfire Fluffy_Pillow 26.0/100: 26% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
2:10.228 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24), ignition_mages_fuse
2:10.997 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(24), ignition_mages_fuse(2)
2:12.108 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power reality_shift, celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(22), ignition_mages_fuse(2)
2:12.986 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.743 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.834 default N sunfire Fluffy_Pillow 32.5/100: 33% astral_power reality_shift, arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.787 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.600 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.559 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.784 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.576 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.370 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.309 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.248 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(12), conch_of_dark_whispers, ignition_mages_fuse(4)
2:23.191 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.107 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.025 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(9), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.197 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(2), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse(5)
2:27.202 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7), conch_of_dark_whispers
2:28.382 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6)
2:29.849 default O moonfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers
2:31.005 default N sunfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(3), conch_of_dark_whispers
2:32.170 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), conch_of_dark_whispers
2:33.340 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers
2:34.310 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:35.769 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:37.229 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:38.375 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
2:39.349 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:40.808 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:41.784 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), conch_of_dark_whispers
2:42.757 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), starlord(3), conch_of_dark_whispers
2:43.903 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), starlord(3), conch_of_dark_whispers
2:45.049 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), starlord(3)
2:46.195 default P stellar_flare Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(6), starlord(3)
2:47.340 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(6)
2:48.588 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:49.800 default N sunfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:50.974 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:52.477 default O moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
2:53.655 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
2:55.156 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2)
2:56.157 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2)
2:57.334 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
2:58.181 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
2:59.450 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power celestial_alignment, solar_empowerment(2), starlord(3)
3:00.296 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, solar_empowerment, starlord(3)
3:01.292 default H ripple_in_space Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
3:02.288 default L sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:03.283 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:04.743 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
3:05.634 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers
3:06.529 default I celestial_alignment Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
3:07.447 default E potion Fluffy_Pillow 85.5/100: 86% astral_power reality_shift, arcanic_pulsar, celestial_alignment, overwhelming_power(22), conch_of_dark_whispers
3:07.447 default F berserking Fluffy_Pillow 85.5/100: 86% astral_power reality_shift, arcanic_pulsar, celestial_alignment, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:07.447 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power berserking, reality_shift, arcanic_pulsar, celestial_alignment, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:08.362 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:09.117 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:10.008 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:10.876 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:11.631 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:12.742 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:13.617 default O moonfire Fluffy_Pillow 6.0/100: 6% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:14.473 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:15.228 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:16.323 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
3:17.187 default Q lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12), battle_potion_of_intellect
3:18.290 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), battle_potion_of_intellect
3:19.159 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:19.914 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:21.137 default N sunfire Fluffy_Pillow 34.0/100: 34% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), battle_potion_of_intellect
3:22.104 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:22.930 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), battle_potion_of_intellect
3:24.166 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(5), battle_potion_of_intellect
3:25.143 default Q lunar_strike Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(4), battle_potion_of_intellect
3:26.393 default M moonfire Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(3), battle_potion_of_intellect
3:27.378 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(2), battle_potion_of_intellect
3:28.516 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(5), overwhelming_power, battle_potion_of_intellect
3:29.759 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
3:30.972 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:32.473 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:33.975 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), torrent_of_elements
3:35.153 default P stellar_flare Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:36.300 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:37.274 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:38.736 default N sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
3:39.882 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements
3:40.855 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements
3:41.829 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
3:42.974 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements
3:44.119 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements
3:45.265 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(8), lunar_empowerment(2), starlord(3), torrent_of_elements
3:46.411 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
3:47.260 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment(3), starlord(3)
3:48.530 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power celestial_alignment, lunar_empowerment(2)
3:49.617 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord
3:50.513 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord
3:51.856 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord
3:52.910 default O moonfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2)
3:54.088 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2)
3:55.589 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2)
3:56.766 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3)
3:57.912 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3)
3:59.058 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3)
4:00.519 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:01.980 default H ripple_in_space Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
4:03.126 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
4:04.271 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:05.245 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:06.706 default G use_items Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
4:06.706 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
4:08.105 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(3), ignition_mages_fuse
4:09.040 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment, ignition_mages_fuse
4:10.237 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power reality_shift, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse
4:11.720 default O moonfire Fluffy_Pillow 38.5/100: 39% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment(2), starlord, ignition_mages_fuse(2)
4:12.837 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar(5), solar_empowerment(2), starlord, ignition_mages_fuse(2)
4:13.955 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), ignition_mages_fuse(2)
4:14.878 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
4:15.924 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
4:17.255 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(3), starlord(2), ignition_mages_fuse(3)
4:18.143 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar(6), solar_empowerment(2), starlord(2), ignition_mages_fuse(3)
4:19.188 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(4)
4:20.020 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:21.267 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:22.099 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3), ignition_mages_fuse(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

unbound force : 36691 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36691.1 36691.1 24.7 / 0.067% 4320.6 / 11.8% 4530.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 36691
Heed My Call 300 (429) 0.8% (1.2%) 8.1 33.85sec 15848 0 Direct 8.1 9107 18224 11096 21.8%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 89922.04 89922.04 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 78.19% 9107.41 8901 9791 9102.71 0 9791 57716 57716 0.00
crit 1.77 21.81% 18224.15 17802 19582 15209.06 0 19582 32206 32206 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 129 0.4% 8.1 33.85sec 4753 0 Direct 8.1 3903 7811 4753 21.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.10 8.10 0.00 0.00 0.0000 0.0000 38517.78 38517.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.34 78.26% 3903.08 3815 4196 3899.65 0 4196 24756 24756 0.00
crit 1.76 21.74% 7811.05 7629 8392 6557.95 0 8392 13762 13762 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5080 13.9% 76.0 3.83sec 19973 15245 Direct 76.0 16587 33110 19973 20.5%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.05 76.05 0.00 0.00 1.3102 0.0000 1518885.78 1518885.78 0.00 15244.81 15244.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.46 79.51% 16587.01 8882 21253 16594.51 15951 17572 1002914 1002914 0.00
crit 15.58 20.49% 33109.66 17765 42507 33124.52 30108 37457 515972 515972 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2515 6.9% 14.0 21.32sec 53587 52469 Direct 14.0 2856 5696 3473 21.7%  
Periodic 220.4 2630 5240 3190 21.4% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 220.42 220.42 1.0213 1.3435 751828.71 751828.71 0.00 2421.71 52469.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.98 78.26% 2855.73 2589 3565 2857.48 2589 3146 31354 31354 0.00
crit 3.05 21.74% 5695.82 5177 7129 5518.18 0 7129 17375 17375 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.1 78.55% 2630.06 2 3319 2631.27 2557 2748 455374 455374 0.00
crit 47.3 21.45% 5240.12 7 6638 5242.65 4897 5655 247725 247725 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 818 2.2% 44.0 6.60sec 5557 0 Direct 44.0 4566 9087 5557 21.9%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.98 43.98 0.00 0.00 0.0000 0.0000 244353.19 244353.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.34 78.08% 4565.61 4180 5756 4567.74 4318 5073 156774 156774 0.00
crit 9.64 21.92% 9086.96 8360 11513 9090.34 8360 11513 87579 87579 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2835 (4487) 7.7% (12.2%) 91.7 3.20sec 14635 16217 Direct 92.2 7639 15258 9195 20.4%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.66 92.18 0.00 0.00 0.9024 0.0000 847597.69 847597.69 0.00 16217.32 16217.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.35 79.57% 7638.88 6967 9594 7643.57 7380 8048 560302 560302 0.00
crit 18.83 20.43% 15257.61 13933 19188 15265.11 14072 16933 287296 287296 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1652 4.5% 73.3 3.99sec 6740 0 Direct 73.3 6740 0 6740 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.27 73.27 0.00 0.00 0.0000 0.0000 493850.45 493850.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.27 100.00% 6739.77 5086 14007 6743.16 5859 8007 493850 493850 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5594.17
  • base_dd_max:5594.17
  • base_dd_mult:1.00
 
Starsurge 11999 32.7% 60.5 4.98sec 59301 56408 Direct 60.3 49266 98235 59487 20.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.47 60.28 0.00 0.00 1.0513 0.0000 3586088.39 3586088.39 0.00 56408.10 56408.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.70 79.13% 49266.20 45067 61614 49290.36 47435 51773 2350082 2350082 0.00
crit 12.58 20.87% 98235.28 90135 123227 98268.37 90135 111907 1236006 1236006 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1632 4.5% 12.7 23.57sec 38367 36977 Direct 12.7 2400 4790 2903 21.1%  
Periodic 218.1 1704 3397 2068 21.5% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.72 12.72 218.08 218.08 1.0376 1.3463 487878.19 487878.19 0.00 1590.32 36977.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.04 78.93% 2399.75 2231 3073 2400.91 2249 2629 24086 24086 0.00
crit 2.68 21.07% 4790.07 4463 6146 4544.49 0 6146 12834 12834 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.2 78.53% 1704.45 2 2151 1705.27 1658 1783 291881 291881 0.00
crit 46.8 21.47% 3396.90 4 4302 3398.10 3206 3694 159077 159077 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5820 15.8% 88.1 3.14sec 19632 0 Direct 88.1 16349 32710 19632 20.1%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.14 88.14 0.00 0.00 0.0000 0.0000 1730382.26 1730382.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.45 79.93% 16348.82 15985 17583 16348.65 15985 17210 1151838 1151838 0.00
crit 17.69 20.07% 32709.55 31970 35167 32709.95 31970 34876 578544 578544 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2802 7.6% 17.9 16.59sec 46713 45568 Direct 17.9 3919 7804 4759 21.6%  
Periodic 219.6 2825 5627 3426 21.4% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.93 17.93 219.60 219.60 1.0252 1.3446 837627.21 837627.21 0.00 2670.66 45567.80
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.06 78.39% 3918.53 3570 4917 3919.55 3650 4247 55076 55076 0.00
crit 3.88 21.61% 7804.23 7141 9834 7696.44 0 9834 30248 30248 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.5 78.56% 2824.85 5 3565 2826.19 2745 2948 487304 487304 0.00
crit 47.1 21.44% 5627.50 10 7129 5629.90 5324 6090 264998 264998 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
The Unbound Force 1111 3.0% 5.0 67.17sec 67175 60356 Periodic 60.5 1321 6799 5503 76.3% 3.3%

Stats details: the_unbound_force

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.95 0.00 39.49 60.47 1.1131 0.2500 332803.49 332803.49 0.00 21631.69 60356.09
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.3 23.66% 1321.47 87 1575 1320.15 1019 1539 18908 18908 0.00
crit 46.2 76.34% 6799.32 434 7875 6799.50 6292 7616 313896 313896 0.00
 
 

Action details: the_unbound_force

Static Values
  • id:298452
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.reckless_force.up|time<5
Spelldata
  • id:298452
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: the_unbound_force_tick

Static Values
  • id:298453
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:50.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:298453
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:{$@spelldesc298452=Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1303.78
  • base_dd_max:1303.78
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.42sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.07sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9015 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.2 44.6sec 5.0sec 92.77% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.28%
  • arcanic_pulsar_2:10.42%
  • arcanic_pulsar_3:11.44%
  • arcanic_pulsar_4:10.55%
  • arcanic_pulsar_5:13.65%
  • arcanic_pulsar_6:10.23%
  • arcanic_pulsar_7:10.82%
  • arcanic_pulsar_8:14.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.13% 7.68% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.82% 32.46% 0.0(0.0) 8.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.4sec 23.67% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.20% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.1 45.9 9.1sec 3.8sec 82.27% 99.71% 1.9(1.9) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.69%
  • lunar_empowerment_2:31.99%
  • lunar_empowerment_3:14.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.8sec 34.1sec 47.63% 0.00% 3.4(47.7) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.40%
  • overwhelming_power_3:1.44%
  • overwhelming_power_4:1.48%
  • overwhelming_power_5:1.52%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.61%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.86%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.97%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.15%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.28%
  • overwhelming_power_20:2.35%
  • overwhelming_power_21:2.42%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.57%
  • overwhelming_power_24:2.64%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 4.0 0.0 66.8sec 66.8sec 5.28% 0.00% 0.0(0.0) 3.9

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.9 84.2 66.8sec 3.3sec 91.58% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.63%
  • reckless_force_counter_2:5.22%
  • reckless_force_counter_3:5.18%
  • reckless_force_counter_4:5.10%
  • reckless_force_counter_5:5.05%
  • reckless_force_counter_6:4.99%
  • reckless_force_counter_7:4.94%
  • reckless_force_counter_8:4.88%
  • reckless_force_counter_9:4.90%
  • reckless_force_counter_10:4.84%
  • reckless_force_counter_11:4.74%
  • reckless_force_counter_12:4.70%
  • reckless_force_counter_13:4.65%
  • reckless_force_counter_14:4.59%
  • reckless_force_counter_15:4.53%
  • reckless_force_counter_16:4.52%
  • reckless_force_counter_17:4.48%
  • reckless_force_counter_18:4.37%
  • reckless_force_counter_19:4.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 24.3 51.4 12.2sec 4.0sec 85.79% 79.62% 0.3(0.3) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.84%
  • solar_empowerment_2:40.06%
  • solar_empowerment_3:17.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.3 20.3sec 5.0sec 97.26% 92.18% 15.3(15.3) 11.4

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.49%
  • starlord_2:22.84%
  • starlord_3:59.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.7sec 45.6sec 23.66% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.66%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 60.5 2418.9 40.0 40.0 1482.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.66 741.23 (31.13%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.36%) 40.00 0.00 0.00%
sunfire Astral Power 17.93 53.79 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 43.98 175.90 (7.39%) 4.00 0.01 0.00%
moonfire Astral Power 14.03 42.09 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.72 101.73 (4.27%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.05 912.52 (38.32%) 12.00 0.06 0.01%
natures_balance Astral Power 399.62 199.81 (8.39%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.20 74.37 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.96 8.08
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.87 0.00 65.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data unbound force Damage Per Second
Count 7672
Mean 36691.13
Minimum 33595.30
Maximum 40730.14
Spread ( max - min ) 7134.84
Range [ ( max - min ) / 2 * 100% ] 9.72%
Standard Deviation 1101.7915
5th Percentile 34925.63
95th Percentile 38540.63
( 95th Percentile - 5th Percentile ) 3615.00
Mean Distribution
Standard Deviation 12.5790
95.00% Confidence Intervall ( 36666.48 - 36715.78 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3464
0.1 Scale Factor Error with Delta=300 10363
0.05 Scale Factor Error with Delta=300 41452
0.01 Scale Factor Error with Delta=300 1036293
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 7672
Mean 36691.13
Minimum 33595.30
Maximum 40730.14
Spread ( max - min ) 7134.84
Range [ ( max - min ) / 2 * 100% ] 9.72%
Standard Deviation 1101.7915
5th Percentile 34925.63
95th Percentile 38540.63
( 95th Percentile - 5th Percentile ) 3615.00
Mean Distribution
Standard Deviation 12.5790
95.00% Confidence Intervall ( 36666.48 - 36715.78 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3464
0.1 Scale Factor Error with Delta=300 10363
0.05 Scale Factor Error with Delta=300 41452
0.01 Scale Factor Error with Delta=300 1036293
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 7672
Mean 36691.13
Minimum 33595.30
Maximum 40730.14
Spread ( max - min ) 7134.84
Range [ ( max - min ) / 2 * 100% ] 9.72%
Damage
Sample Data unbound force Damage
Count 7672
Mean 10959735.18
Minimum 8598427.99
Maximum 13513108.96
Spread ( max - min ) 4914680.97
Range [ ( max - min ) / 2 * 100% ] 22.42%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
H 4.95 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.87 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.47 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.08 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.73 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.48 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.30 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.72 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.42 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.91 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.37 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQKRQRKRQNRQORQRKPKRLQKQQQRQKRKRQRQRMJKKQQKNPRQRKRQHQRQRKKNORQQKRPQRQQRJKNRSKRMQQRKRQRKPRQQKNRQKORQKRQKRQQNPKRHQKGRQRKRMQQKNRQQRKQPKRQRQKORQNRRRQRRKKQQKPRQNOQRRRRKRQKRKLQIEFKRKPRQORKRQRQRQKRQHKNQQKRQOPQQJKNRKRQMRKRQKRQRQPNKRQKRGQKORQQKRQQRRRKK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H the_unbound_force Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.249 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, battle_potion_of_intellect
0:02.211 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:03.144 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:04.077 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(2), battle_potion_of_intellect
0:05.012 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(2), battle_potion_of_intellect
0:05.823 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect
0:05.823 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect
0:05.823 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.578 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.334 default Q lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.210 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.965 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.720 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.573 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.327 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.081 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.901 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.656 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.409 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.163 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.951 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.705 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.458 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.247 default O moonfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.002 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.756 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(8), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.592 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.346 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, torrent_of_elements, overwhelming_power(24), reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.100 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.856 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), reckless_force_counter(9), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.611 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), reckless_force_counter(9), ignition_mages_fuse(5)
0:24.365 default L sunfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(21), reckless_force_counter(9), ignition_mages_fuse(5)
0:25.119 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20), reckless_force_counter(10), ignition_mages_fuse(5)
0:26.017 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(19), reckless_force_counter(10)
0:26.864 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), reckless_force_counter(11)
0:27.911 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), reckless_force_counter(11)
0:28.963 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), reckless_force_counter(11)
0:30.019 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(11)
0:30.775 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(12)
0:31.839 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(12)
0:32.678 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), reckless_force_counter(12)
0:33.433 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(12)
0:34.185 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(12)
0:34.940 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(11), reckless_force_counter(12)
0:35.879 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), reckless_force_counter(12)
0:36.635 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), reckless_force_counter(13)
0:37.581 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), reckless_force_counter(13)
0:38.335 default M moonfire Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), reckless_force_counter(13)
0:39.089 default J cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), reckless_force_counter(13)
0:39.089 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, torrent_of_elements, overwhelming_power(6), reckless_force_counter(13)
0:40.028 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(5), reckless_force_counter(13)
0:40.945 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), reckless_force_counter(13)
0:42.081 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(3), reckless_force_counter(14)
0:43.566 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(2), reckless_force_counter(14)
0:44.736 default N sunfire Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power, reckless_force_counter(15)
0:45.876 default P stellar_flare Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(16)
0:47.020 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(17)
0:47.995 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(17)
0:49.454 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(17)
0:50.427 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(18)
0:51.573 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(19)
0:52.545 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(19)
0:54.004 default H the_unbound_force Fluffy_Pillow 35.0/100: 35% astral_power reckless_force, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:55.149 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power reckless_force, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:56.609 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power reckless_force, arcanic_pulsar(5), solar_empowerment(3), starlord(3), torrent_of_elements
0:57.583 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:59.042 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter
0:59.932 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(25), reckless_force_counter
1:01.071 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23), reckless_force_counter(2)
1:02.188 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22), reckless_force_counter(2)
1:03.275 default O moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(21), reckless_force_counter(3)
1:04.365 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(20), reckless_force_counter(4)
1:05.297 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), reckless_force_counter(5)
1:06.697 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), reckless_force_counter(6)
1:08.100 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(16), reckless_force_counter(6)
1:09.211 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15), reckless_force_counter(6)
1:10.135 default P stellar_flare Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(7)
1:11.224 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), reckless_force_counter(7)
1:12.617 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12), reckless_force_counter(8)
1:13.549 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(8)
1:14.951 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(8)
1:16.357 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(8), reckless_force_counter(8)
1:17.302 default J cancel_buff Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(9)
1:17.302 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power arcanic_pulsar(8), solar_empowerment(2), overwhelming_power(7), reckless_force_counter(9)
1:18.518 default N sunfire Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(6), reckless_force_counter(9)
1:19.550 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(5), reckless_force_counter(10)
1:20.431 default S sunfire Fluffy_Pillow 85.0/100: 85% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(4), reckless_force_counter(10)
1:21.468 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(3), reckless_force_counter(10)
1:22.509 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(2), overwhelming_power(2), reckless_force_counter(10)
1:23.374 default M moonfire Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power, reckless_force_counter(11)
1:24.396 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(2), reckless_force_counter(11)
1:25.896 default Q lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(11)
1:27.399 default R solar_wrath Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(2), reckless_force_counter(11)
1:28.399 default K starsurge Fluffy_Pillow 96.0/100: 96% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(11)
1:29.576 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(3), starlord(3), reckless_force_counter(11)
1:30.550 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(11)
1:32.010 default R solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(11)
1:32.984 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(12)
1:34.130 default P stellar_flare Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord(3), reckless_force_counter(12)
1:35.274 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord(3), reckless_force_counter(12)
1:36.247 default Q lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(12)
1:37.707 default Q lunar_strike Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), reckless_force_counter(12)
1:39.298 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), reckless_force_counter(13)
1:40.546 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord, reckless_force_counter(13)
1:41.758 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord, reckless_force_counter(13)
1:42.788 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(13)
1:44.332 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(14)
1:45.545 default O moonfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(15)
1:46.722 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(15)
1:47.724 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(15)
1:49.225 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(15)
1:50.402 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(15)
1:51.374 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(16)
1:52.834 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(16)
1:53.979 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(16)
1:54.951 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(16)
1:56.409 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(16)
1:57.868 default N sunfire Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(18)
1:59.013 default P stellar_flare Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(18)
2:00.159 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(7), solar_empowerment(2), reckless_force_counter(19)
2:01.409 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, reckless_force_counter(19)
2:02.441 default H the_unbound_force Fluffy_Pillow 36.0/100: 36% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord
2:03.652 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord
2:05.197 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord
2:06.408 default G use_items Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2)
2:06.408 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse
2:07.244 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), ignition_mages_fuse
2:08.494 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter, ignition_mages_fuse
2:09.331 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), reckless_force_counter(2), ignition_mages_fuse
2:10.316 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(2), ignition_mages_fuse
2:11.128 default M moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(2), ignition_mages_fuse(2)
2:12.049 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(2), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.393 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:14.738 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.754 default N sunfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(25), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.692 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(24), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.495 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse(3)
2:18.698 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.863 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(21), reckless_force_counter(3), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.646 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(2), solar_empowerment, overwhelming_power(20), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.648 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(19), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(4)
2:22.893 default P stellar_flare Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, overwhelming_power(18), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.842 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, overwhelming_power(17), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.793 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(16), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(5)
2:25.579 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter(5), conch_of_dark_whispers, ignition_mages_fuse(5)
2:26.761 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(14), reckless_force_counter(6), conch_of_dark_whispers
2:27.710 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13), reckless_force_counter(7)
2:29.139 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(11), reckless_force_counter(7)
2:30.270 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10), reckless_force_counter(8)
2:31.376 default R solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9), reckless_force_counter(8)
2:32.318 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), reckless_force_counter(8)
2:33.734 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(7), reckless_force_counter(8)
2:34.850 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(6), reckless_force_counter(8)
2:35.801 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(5), reckless_force_counter(9)
2:36.758 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(4), reckless_force_counter(9)
2:37.717 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(3), overwhelming_power(3), reckless_force_counter(9)
2:39.160 default R solar_wrath Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power, reckless_force_counter(9)
2:40.130 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(5), starlord(3), reckless_force_counter(9)
2:41.274 default K starsurge Fluffy_Pillow 94.0/100: 94% astral_power arcanic_pulsar(5), lunar_empowerment, reckless_force_counter(9)
2:42.522 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord, reckless_force_counter(9)
2:43.733 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25), reckless_force_counter(10)
2:45.104 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter(11)
2:46.485 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), reckless_force_counter(11)
2:47.573 default P stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(21), reckless_force_counter(11)
2:48.635 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20), reckless_force_counter(12)
2:49.544 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter(13)
2:50.878 default N sunfire Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(13)
2:51.929 default O moonfire Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), reckless_force_counter(13)
2:52.983 default Q lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(14)
2:54.320 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(15), conch_of_dark_whispers
2:55.222 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(21), reckless_force_counter(15), conch_of_dark_whispers
2:56.125 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(20), reckless_force_counter(15), conch_of_dark_whispers
2:57.191 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(19), reckless_force_counter(15), conch_of_dark_whispers
2:58.258 default K starsurge Fluffy_Pillow 99.0/100: 99% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(18), reckless_force_counter(15), conch_of_dark_whispers
2:59.330 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(15), conch_of_dark_whispers
3:00.126 default Q lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(16), reckless_force_counter(15), conch_of_dark_whispers
3:01.324 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power celestial_alignment, overwhelming_power(15), reckless_force_counter(15), conch_of_dark_whispers
3:02.352 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), reckless_force_counter(15), conch_of_dark_whispers
3:03.202 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord, overwhelming_power(13), reckless_force_counter(15), conch_of_dark_whispers
3:04.207 default L sunfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(12), reckless_force_counter(16), conch_of_dark_whispers
3:05.186 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11), reckless_force_counter(16), conch_of_dark_whispers
3:06.627 default I celestial_alignment Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(10), reckless_force_counter(16), conch_of_dark_whispers
3:07.613 default E potion Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9), reckless_force_counter(16), conch_of_dark_whispers
3:07.613 default F berserking Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:07.613 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(9), reckless_force_counter(16), conch_of_dark_whispers, battle_potion_of_intellect
3:08.513 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8), reckless_force_counter(16), battle_potion_of_intellect
3:09.268 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(7), reckless_force_counter(16), battle_potion_of_intellect
3:10.150 default P stellar_flare Fluffy_Pillow 14.0/100: 14% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(6), reckless_force_counter(16), battle_potion_of_intellect
3:11.035 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(5), reckless_force_counter(16), battle_potion_of_intellect
3:11.790 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), reckless_force_counter(16), battle_potion_of_intellect
3:12.923 default O moonfire Fluffy_Pillow 48.0/100: 48% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), reckless_force_counter(16), battle_potion_of_intellect
3:13.817 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), reckless_force_counter(16), battle_potion_of_intellect
3:14.579 default K starsurge Fluffy_Pillow 60.0/100: 60% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), reckless_force_counter(17), battle_potion_of_intellect
3:15.477 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power, reckless_force_counter(17), battle_potion_of_intellect
3:16.246 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(17), battle_potion_of_intellect
3:17.401 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(18), battle_potion_of_intellect
3:18.171 default Q lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(18), battle_potion_of_intellect
3:19.326 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(18), battle_potion_of_intellect
3:20.233 default Q lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(18), battle_potion_of_intellect
3:21.503 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, torrent_of_elements, reckless_force_counter(18), conch_of_dark_whispers, battle_potion_of_intellect
3:22.592 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, reckless_force_counter(18), conch_of_dark_whispers, battle_potion_of_intellect
3:23.487 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(19), conch_of_dark_whispers, battle_potion_of_intellect
3:24.829 default H the_unbound_force Fluffy_Pillow 71.0/100: 71% astral_power reckless_force, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:25.884 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power reckless_force, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:26.939 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:28.116 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:29.616 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:31.117 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers, battle_potion_of_intellect
3:32.295 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers, battle_potion_of_intellect
3:33.269 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:34.728 default O moonfire Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:35.873 default P stellar_flare Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:37.019 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:38.479 default Q lunar_strike Fluffy_Pillow 82.0/100: 82% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:39.938 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:39.938 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar(8), solar_empowerment(2), torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:41.187 default N sunfire Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:42.240 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, reckless_force_counter(2), conch_of_dark_whispers
3:43.136 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, reckless_force_counter(3), conch_of_dark_whispers
3:44.189 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, reckless_force_counter(3), conch_of_dark_whispers
3:45.063 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(3)
3:46.367 default M moonfire Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), reckless_force_counter(3)
3:47.391 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(2), reckless_force_counter(3)
3:48.393 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(4)
3:49.571 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(4)
3:50.542 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(4)
3:52.002 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(4)
3:53.147 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(4)
3:54.119 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(5)
3:55.578 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(5)
3:56.552 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(5)
3:58.011 default P stellar_flare Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(6)
3:59.156 default N sunfire Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(7)
4:00.301 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), reckless_force_counter(7)
4:01.550 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord, reckless_force_counter(7)
4:02.580 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord, reckless_force_counter(7)
4:04.125 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(7)
4:05.338 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter(8)
4:06.339 default G use_items Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(9)
4:06.339 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter(9), ignition_mages_fuse
4:07.779 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(9), ignition_mages_fuse
4:08.911 default O moonfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(9), ignition_mages_fuse
4:10.011 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(9), ignition_mages_fuse
4:10.945 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(9), ignition_mages_fuse(2)
4:12.291 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(10), ignition_mages_fuse(2)
4:13.637 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(11), ignition_mages_fuse(2)
4:14.693 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(11), ignition_mages_fuse(3)
4:15.557 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(11), ignition_mages_fuse(3)
4:16.853 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(11), ignition_mages_fuse(3)
4:18.149 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(11), ignition_mages_fuse(3)
4:19.015 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(11), ignition_mages_fuse(4)
4:19.847 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(13), ignition_mages_fuse(4)
4:20.827 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(7), reckless_force_counter(14), ignition_mages_fuse(4)
4:21.892 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(14), ignition_mages_fuse(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

visions : 39556 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
39555.6 39555.6 39.5 / 0.100% 6972.2 / 17.6% 4625.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.4 Astral Power 0.00% 59.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 39556
Heed My Call 302 (432) 0.8% (1.1%) 8.3 32.68sec 15510 0 Direct 8.3 9195 18390 10856 18.1%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.0000 0.0000 90434.39 90434.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.82 81.93% 9195.21 8987 9886 9196.92 8987 9886 62749 62749 0.00
crit 1.51 18.07% 18390.00 17974 19771 14501.64 0 19771 27686 27686 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.3 32.68sec 4653 0 Direct 8.3 3941 7882 4653 18.1%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.33 8.33 0.00 0.00 0.0000 0.0000 38759.81 38759.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.82 81.92% 3940.70 3852 4237 3939.92 0 4237 26890 26890 0.00
crit 1.51 18.08% 7882.35 7703 8473 6203.90 0 8473 11870 11870 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5279 13.3% 78.8 3.72sec 20044 15549 Direct 78.8 17003 33989 20044 17.9%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.79 78.79 0.00 0.00 1.2891 0.0000 1579321.37 1579321.37 0.00 15548.63 15548.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.69 82.10% 17002.73 8968 21459 17004.74 16230 17867 1099872 1099872 0.00
crit 14.11 17.90% 33988.82 17937 42918 33991.62 29752 38513 479450 479450 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2564 6.5% 14.2 21.19sec 53871 53439 Direct 14.2 2907 5807 3426 17.9%  
Periodic 225.2 2705 5405 3189 17.9% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.24 14.24 225.24 225.24 1.0081 1.3192 767174.12 767174.12 0.00 2462.86 53439.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.69 82.10% 2907.21 2614 3599 2907.34 2676 3172 33989 33989 0.00
crit 2.55 17.90% 5807.43 5227 7198 5436.85 0 7198 14808 14808 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.8 82.07% 2705.36 2 3351 2705.60 2617 2853 500086 500086 0.00
crit 40.4 17.93% 5404.52 4 6702 5404.79 5047 5915 218291 218291 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 833 2.1% 44.9 6.50sec 5545 0 Direct 44.9 4696 9385 5545 18.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.93 44.93 0.00 0.00 0.0000 0.0000 249122.70 249122.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.80 81.90% 4696.01 4220 5812 4696.33 4324 5061 172801 172801 0.00
crit 8.13 18.10% 9385.35 8441 11624 9379.52 0 11624 76321 76321 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2950 (4709) 7.5% (11.9%) 94.3 3.12sec 14939 16840 Direct 94.9 7884 15758 9303 18.0%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.32 94.88 0.00 0.00 0.8871 0.0000 882607.68 882607.68 0.00 16839.70 16839.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.78 81.98% 7883.91 7034 9687 7885.53 7592 8305 613236 613236 0.00
crit 17.09 18.02% 15757.68 14068 19373 15759.18 14068 17680 269371 269371 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1759 4.4% 77.3 3.79sec 6809 0 Direct 77.3 6809 0 6809 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.32 77.32 0.00 0.00 0.0000 0.0000 526437.07 526437.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.32 100.00% 6808.89 5135 14142 6808.86 5923 8051 526437 526437 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5134.81
  • base_dd_max:5134.81
  • base_dd_mult:1.00
 
Starsurge 12740 32.2% 64.0 4.73sec 59579 57606 Direct 63.7 50723 101297 59806 18.0%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.99 63.74 0.00 0.00 1.0343 0.0000 3812173.16 3812173.16 0.00 57605.71 57605.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.30 82.04% 50723.47 45503 62210 50723.49 48799 53518 2652689 2652689 0.00
crit 11.45 17.96% 101297.08 91007 124420 101288.28 91007 113639 1159484 1159484 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1665 4.2% 12.8 23.57sec 39020 37811 Direct 12.8 2475 4949 2922 18.1%  
Periodic 222.8 1753 3504 2068 18.0% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.76 12.76 222.84 222.84 1.0320 1.3219 498014.14 498014.14 0.00 1618.26 37811.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.46 81.93% 2474.71 2253 3103 2475.23 2275 2739 25879 25879 0.00
crit 2.31 18.07% 4948.50 4506 6205 4553.31 0 6205 11410 11410 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.8 82.04% 1753.16 2 2172 1753.33 1697 1834 320518 320518 0.00
crit 40.0 17.96% 3503.94 22 4344 3503.94 3263 3787 140208 140208 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 8480 21.5% 130.5 2.21sec 19470 0 Direct 130.5 16518 33047 19470 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 130.49 130.49 0.00 0.00 0.0000 0.0000 2540745.81 2540745.81 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.18 82.14% 16517.51 16140 17753 16516.65 16140 17324 1770360 1770360 0.00
crit 23.31 17.86% 33046.77 32279 35507 33045.76 32279 35317 770386 770386 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2854 7.2% 17.9 16.69sec 47597 47133 Direct 17.9 4019 8040 4741 18.0%  
Periodic 224.4 2905 5807 3427 18.0% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.94 17.94 224.35 224.35 1.0098 1.3203 853865.94 853865.94 0.00 2716.45 47133.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.72 82.05% 4018.60 3605 4964 4018.49 3705 4331 59152 59152 0.00
crit 3.22 17.95% 8039.70 7210 9929 7761.61 0 9929 25890 25890 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.0 82.03% 2905.42 2 3599 2905.69 2815 3057 534707 534707 0.00
crit 40.3 17.97% 5807.04 34 7198 5807.04 5204 6244 234117 234117 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 188.67sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.4 154.57sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.37 0.00 0.00 0.00 0.9078 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:150.388
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.5 56.2 42.5sec 4.7sec 93.10% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.34%
  • arcanic_pulsar_2:10.82%
  • arcanic_pulsar_3:11.54%
  • arcanic_pulsar_4:10.77%
  • arcanic_pulsar_5:13.06%
  • arcanic_pulsar_6:11.07%
  • arcanic_pulsar_7:11.06%
  • arcanic_pulsar_8:13.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 111.9sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 188.5sec 188.5sec 8.13% 8.21% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 9.9 0.0 31.2sec 31.2sec 38.71% 46.46% 0.0(0.0) 9.5

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:38.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.7sec 45.3sec 23.76% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.76%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.4 0.0 154.6sec 154.6sec 15.19% 0.00% 2.2(2.2) 2.2

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.12%
  • ignition_mages_fuse_2:3.08%
  • ignition_mages_fuse_3:3.04%
  • ignition_mages_fuse_4:3.00%
  • ignition_mages_fuse_5:2.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 28.9 54.1 10.4sec 3.6sec 85.74% 98.98% 3.3(3.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:32.15%
  • lunar_empowerment_2:32.95%
  • lunar_empowerment_3:20.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.6 3.5 64.5sec 33.6sec 48.20% 0.00% 3.5(49.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.9 51.8 10.6sec 3.8sec 84.70% 81.58% 0.3(0.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:30.46%
  • solar_empowerment_2:38.00%
  • solar_empowerment_3:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.4 48.6 20.1sec 4.7sec 97.98% 92.98% 18.2(18.2) 10.6

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.09%
  • starlord_2:21.97%
  • starlord_3:61.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.3sec 23.70% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.70%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vision of Perfection 4.0 0.6 61.6sec 52.0sec 14.09% 0.00% 0.6(0.6) 3.9

Buff details

  • buff initial source:visions
  • cooldown name:buff_vision_of_perfection
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:116.09

Stack Uptimes

  • vision_of_perfection_1:14.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303344
  • name:Vision of Perfection
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc303342=When Vision of Perfection activates, you and {$s1=2} other nearby allies gain {$s2=0} Haste for {$303344d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:visions
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 64.0 2559.4 40.0 40.0 1489.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.32 762.01 (30.20%) 7.99 0.56 0.07%
celestial_alignment Astral Power 2.37 94.67 (3.75%) 40.00 0.00 0.00%
sunfire Astral Power 17.94 53.82 (2.13%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.93 179.69 (7.12%) 4.00 0.04 0.02%
moonfire Astral Power 14.24 42.72 (1.69%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.76 102.08 (4.05%) 8.00 0.02 0.02%
lunar_strike Astral Power 78.79 945.01 (37.45%) 11.99 0.51 0.05%
natures_balance Astral Power 399.62 199.79 (7.92%) 0.50 0.02 0.01%
arcanic_pulsar Astral Power 6.63 79.59 (3.15%) 12.00 0.00 0.00%
vision_of_perfection Astral Power 4.59 64.12 (2.54%) 13.97 0.14 0.22%
Resource RPS-Gain RPS-Loss
Astral Power 8.43 8.55
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.37 0.00 93.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data visions Damage Per Second
Count 7672
Mean 39555.59
Minimum 33626.91
Maximum 46424.74
Spread ( max - min ) 12797.83
Range [ ( max - min ) / 2 * 100% ] 16.18%
Standard Deviation 1766.1752
5th Percentile 36877.44
95th Percentile 42631.07
( 95th Percentile - 5th Percentile ) 5753.63
Mean Distribution
Standard Deviation 20.1641
95.00% Confidence Intervall ( 39516.07 - 39595.11 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 77
0.1% Error 7659
0.1 Scale Factor Error with Delta=300 26629
0.05 Scale Factor Error with Delta=300 106516
0.01 Scale Factor Error with Delta=300 2662878
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 7672
Mean 39555.59
Minimum 33626.91
Maximum 46424.74
Spread ( max - min ) 12797.83
Range [ ( max - min ) / 2 * 100% ] 16.18%
Standard Deviation 1766.1752
5th Percentile 36877.44
95th Percentile 42631.07
( 95th Percentile - 5th Percentile ) 5753.63
Mean Distribution
Standard Deviation 20.1641
95.00% Confidence Intervall ( 39516.07 - 39595.11 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 77
0.1% Error 7659
0.1 Scale Factor Error with Delta=300 26629
0.05 Scale Factor Error with Delta=300 106516
0.01 Scale Factor Error with Delta=300 2662878
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 7672
Mean 39555.59
Minimum 33626.91
Maximum 46424.74
Spread ( max - min ) 12797.83
Range [ ( max - min ) / 2 * 100% ] 16.18%
Damage
Sample Data visions Damage
Count 7672
Mean 11838656.19
Minimum 8743584.04
Maximum 15939110.72
Spread ( max - min ) 7195526.68
Range [ ( max - min ) / 2 * 100% ] 30.39%
DTPS
Sample Data visions Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.36 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.37 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.78 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 63.98 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.61 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.18 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 13.80 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.06 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.76 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 79.10 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.57 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.54 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQJQPQJQPMQPNQPQJOJQPPJPPQQPQQJMJQJQPQPNQJQJQPKOJPPPJPQQQQPJNMJPPOQJQPJQPKPQQQJJNPPQJPQOQJMPQQQQJPJNPQJPQMQQOQQPIJQJQPJLPPJMQPPPQQOJJPPJQMNPQJPQQPQPJPJOJQPQKHEGJNQJQPQPIJQPJFMQPJQOQPJQNQPJQPQPQJQMQPJQPJQLOPJPPPQMJJQPPQJQPPJNOQMPPQJQPQJQPQPQJPPJQJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.250 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.184 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.116 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.050 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.862 default F berserking Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.862 default G use_items Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.862 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.617 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.371 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.127 default Q solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.882 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.734 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.488 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.242 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.997 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.816 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.570 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.324 default Q solar_wrath Fluffy_Pillow 0.5/100: 1% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.079 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.867 default M sunfire Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.620 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.375 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.165 default N moonfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.920 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.675 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.512 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.267 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.021 default O stellar_flare Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.776 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.530 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.286 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:24.116 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(24), ignition_mages_fuse(5)
0:25.004 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(23)
0:25.840 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23)
0:26.875 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25)
0:27.903 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(25)
0:28.657 default Q solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(24)
0:29.411 default P lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(23)
0:30.446 default Q solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(22)
0:31.260 default Q solar_wrath Fluffy_Pillow 82.5/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(21)
0:32.078 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(20)
0:32.898 default M sunfire Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), vision_of_perfection
0:33.652 default J starsurge Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), vision_of_perfection
0:34.405 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), vision_of_perfection
0:35.159 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), vision_of_perfection
0:35.915 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), vision_of_perfection
0:36.669 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), vision_of_perfection
0:37.577 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), vision_of_perfection
0:38.329 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(14), vision_of_perfection
0:39.244 default N moonfire Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), vision_of_perfection
0:39.998 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(13), vision_of_perfection
0:40.753 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, overwhelming_power(12), vision_of_perfection
0:41.542 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(11), vision_of_perfection
0:42.390 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(10), vision_of_perfection
0:43.392 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(9)
0:44.234 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(8)
0:45.501 default K sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(7)
0:46.499 default O stellar_flare Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), starlord(2), overwhelming_power(6)
0:47.650 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment(2), starlord(2), overwhelming_power(5)
0:48.809 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4)
0:50.247 default P lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(2)
0:51.694 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power
0:53.147 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3)
0:54.291 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
0:55.751 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), torrent_of_elements
0:56.725 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements
0:57.697 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
0:58.669 default Q solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements
0:59.815 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements
1:01.276 default J starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(6), torrent_of_elements
1:02.526 default N moonfire Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:03.738 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:04.950 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:06.162 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:07.663 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:09.162 default O stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25)
1:10.237 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(24)
1:11.156 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(23)
1:12.240 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
1:13.021 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21)
1:14.196 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(20)
1:15.123 default Q solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19)
1:15.915 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19)
1:17.100 default K sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17)
1:18.037 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16)
1:19.410 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(15)
1:20.332 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(14)
1:21.259 default Q solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar, starlord(3), overwhelming_power(13)
1:22.351 default J starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar, overwhelming_power(12)
1:23.545 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11)
1:24.708 default N moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
1:25.844 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9)
1:27.295 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
1:28.670 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(23)
1:29.591 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(22)
1:30.678 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
1:32.030 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:32.941 default O stellar_flare Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(19)
1:34.009 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(17)
1:34.925 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(17)
1:36.003 default M sunfire Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15)
1:37.088 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14)
1:38.475 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(13)
1:39.404 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(12)
1:40.501 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(11)
1:41.601 default Q solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(10)
1:42.707 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(5), overwhelming_power(9)
1:43.916 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8)
1:45.415 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(6)
1:46.601 default N moonfire Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5)
1:47.757 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4)
1:49.236 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(2)
1:50.232 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power
1:51.406 default P lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:52.866 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:53.840 default M sunfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
1:54.984 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
1:55.957 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:57.103 default O stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:58.249 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:59.394 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
2:00.539 default P lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
2:01.998 default I cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
2:01.998 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(8), conch_of_dark_whispers
2:03.247 default Q solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
2:04.142 default J starsurge Fluffy_Pillow 72.5/100: 73% astral_power celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers
2:05.195 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers
2:06.067 default P lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), conch_of_dark_whispers
2:07.370 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(25)
2:08.305 default L moonfire Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(24)
2:09.221 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23)
2:10.564 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22)
2:11.913 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
2:12.975 default M sunfire Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
2:14.041 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18)
2:14.953 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18)
2:16.319 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
2:17.695 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
2:19.075 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(13)
2:20.005 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(12)
2:20.937 default O stellar_flare Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(12)
2:22.034 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(3), overwhelming_power(10)
2:23.238 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9)
2:24.411 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8), conch_of_dark_whispers
2:25.866 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), conch_of_dark_whispers
2:27.328 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers
2:28.485 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:29.444 default M sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers
2:30.576 default N moonfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
2:31.713 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers
2:33.165 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:34.138 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), conch_of_dark_whispers
2:35.284 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:36.743 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), conch_of_dark_whispers
2:37.716 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers
2:38.690 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3)
2:40.151 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(7), starlord(3)
2:41.299 default P lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3)
2:42.760 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(7)
2:44.008 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:45.554 default J starsurge Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), solar_empowerment, starlord
2:46.767 default O stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:47.791 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:48.816 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:49.663 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:50.933 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
2:51.779 default K sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
2:52.775 default H celestial_alignment Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
2:53.771 default E potion Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
2:53.771 default G use_items Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect
2:53.771 default J starsurge Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
2:54.727 default N moonfire Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
2:55.684 default Q solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse
2:56.488 default J starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse
2:57.431 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse
2:58.233 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
2:59.388 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
3:00.160 default P lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
3:01.314 default I cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
3:01.314 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
3:02.302 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
3:03.088 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
3:04.266 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord, vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
3:05.189 default F berserking Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
3:05.189 default M sunfire Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
3:06.006 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(4)
3:06.758 default P lunar_strike Fluffy_Pillow 55.5/100: 56% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(2), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(4)
3:07.760 default J starsurge Fluffy_Pillow 68.0/100: 68% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(4)
3:08.557 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
3:09.311 default O stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
3:10.087 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(5)
3:10.843 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
3:11.795 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
3:12.549 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
3:13.304 default N moonfire Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect, ignition_mages_fuse(5)
3:14.058 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:14.964 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:16.118 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, battle_potion_of_intellect
3:17.025 default Q solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
3:17.797 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), battle_potion_of_intellect
3:18.957 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
3:19.871 default P lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
3:21.039 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
3:21.961 default J starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(21)
3:22.969 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20)
3:23.803 default M sunfire Fluffy_Pillow 57.5/100: 57% astral_power celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(19)
3:24.786 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(18)
3:25.773 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(17)
3:27.038 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(15)
3:28.037 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(14)
3:28.864 default P lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(14)
3:30.104 default J starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(12)
3:31.085 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(11)
3:31.899 default L moonfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(11)
3:32.857 default O stellar_flare Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(10)
3:33.962 default P lunar_strike Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), overwhelming_power(9)
3:35.375 default J starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(7)
3:36.492 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(6)
3:37.919 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5)
3:39.350 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3)
3:40.795 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(2)
3:41.762 default M sunfire Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power
3:42.904 default J starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(3), solar_empowerment, torrent_of_elements
3:44.153 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
3:45.364 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements
3:46.367 default P lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
3:47.868 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:49.370 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2), torrent_of_elements
3:50.371 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(25)
3:51.448 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
3:52.342 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
3:53.687 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
3:55.035 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(20)
3:56.099 default N moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19)
3:57.168 default O stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18)
3:58.240 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17)
3:59.156 default M sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
4:00.237 default P lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15)
4:01.618 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
4:03.003 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), solar_empowerment(3), overwhelming_power(12)
4:04.020 default J starsurge Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), overwhelming_power(11)
4:05.218 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(10)
4:06.210 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(9)
4:07.704 default Q solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(8)
4:08.706 default J starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(7)
4:09.885 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(6)
4:10.737 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(5)
4:12.019 default Q solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(3), conch_of_dark_whispers
4:12.881 default P lunar_strike Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(3), conch_of_dark_whispers
4:14.171 default Q solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power, conch_of_dark_whispers
4:15.038 default J starsurge Fluffy_Pillow 91.0/100: 91% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
4:16.060 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:17.520 default P lunar_strike Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:18.980 default J starsurge Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:20.125 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:21.101 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 5.59% 5.59% 475
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

worldvein : 36722 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
36722.3 36722.3 25.5 / 0.069% 4365.8 / 11.9% 4544.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 7.9 Astral Power 0.00% 57.9 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 36722
Heed My Call 293 (419) 0.8% (1.1%) 8.2 33.19sec 15357 0 Direct 8.2 9107 18216 10750 18.0%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 87788.02 87788.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 81.97% 9107.45 8901 9791 9105.26 0 9791 60963 60963 0.00
crit 1.47 18.03% 18215.57 17802 19582 14128.93 0 19582 26825 26825 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 126 0.3% 8.2 33.19sec 4607 0 Direct 8.2 3904 7803 4607 18.0%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.17 8.17 0.00 0.00 0.0000 0.0000 37625.63 37625.63 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 81.95% 3903.61 3815 4196 3903.37 3815 4196 26125 26125 0.00
crit 1.47 18.05% 7802.84 7629 8392 6069.56 0 8392 11501 11501 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5330 14.5% 75.9 3.84sec 20998 16040 Direct 75.9 17796 35583 20998 18.0%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.90 75.90 0.00 0.00 1.3091 0.0000 1593829.15 1593829.15 0.00 16040.31 16040.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.24 82.00% 17796.32 9382 22717 17803.59 17120 18612 1107689 1107689 0.00
crit 13.66 18.00% 35583.24 18430 45434 35603.64 32092 41527 486140 486140 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2618 7.1% 14.1 21.32sec 55703 54517 Direct 14.1 3058 6121 3603 17.8%  
Periodic 220.3 2818 5632 3323 17.9% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.05 14.05 220.35 220.35 1.0218 1.3440 782754.22 782754.22 0.00 2520.86 54516.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.55 82.20% 3058.21 2589 3810 3059.90 2821 3318 35326 35326 0.00
crit 2.50 17.80% 6121.17 5274 7620 5726.51 0 7620 15310 15310 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.8 82.07% 2818.24 2 3547 2819.52 2741 2943 509658 509658 0.00
crit 39.5 17.93% 5631.60 17 7095 5633.75 5271 6093 222460 222460 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 848 2.3% 43.9 6.62sec 5774 0 Direct 43.9 4891 9769 5774 18.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.89 43.89 0.00 0.00 0.0000 0.0000 253432.45 253432.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.95 81.91% 4891.37 4180 6153 4893.47 4616 5284 175850 175850 0.00
crit 7.94 18.09% 9769.48 8360 12305 9772.06 0 12305 77582 77582 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 2963 (4693) 8.1% (12.8%) 91.2 3.21sec 15382 17066 Direct 91.7 8190 16371 9657 17.9%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.22 91.75 0.00 0.00 0.9013 0.0000 885989.61 885989.61 0.00 17065.96 17065.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.30 82.07% 8190.09 6967 10255 8194.91 7892 8653 616688 616688 0.00
crit 16.45 17.93% 16370.72 13933 20509 16378.30 14977 19199 269301 269301 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1730 4.7% 73.1 3.99sec 7077 0 Direct 73.1 7077 0 7077 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.08 73.08 0.00 0.00 0.0000 0.0000 517190.82 517190.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.08 100.00% 7077.24 5086 14972 7080.87 6138 8281 517191 517191 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:10932.99
  • base_dd_max:10932.99
  • base_dd_mult:1.00
 
Starsurge 12449 33.9% 60.3 4.99sec 61668 58673 Direct 60.1 52484 104904 61864 17.9%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.33 60.14 0.00 0.00 1.0511 0.0000 3720651.07 3720651.07 0.00 58673.32 58673.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.38 82.10% 52484.17 45067 65508 52508.00 50639 55266 2591565 2591565 0.00
crit 10.76 17.90% 104903.80 90135 131016 104942.96 94749 119964 1129086 1129086 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1700 4.6% 12.7 23.57sec 39965 38466 Direct 12.7 2568 5127 3025 17.9%  
Periodic 218.0 1827 3650 2155 18.0% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.71 12.71 217.99 217.99 1.0391 1.3467 508131.28 508131.28 0.00 1656.31 38465.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 82.15% 2567.74 2231 3285 2568.72 2383 2796 26819 26819 0.00
crit 2.27 17.85% 5127.15 4546 6569 4674.90 0 6569 11637 11637 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 178.8 82.01% 1826.53 1 2299 1827.40 1781 1901 326556 326556 0.00
crit 39.2 17.99% 3650.45 2 4599 3651.75 3426 3953 143119 143119 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5748 15.6% 88.7 3.13sec 19275 0 Direct 88.7 16353 32703 19276 17.9%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 88.66 88.66 0.00 0.00 0.0000 0.0000 1708962.70 1708962.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.81 82.13% 16353.20 15985 17583 16352.91 15985 17336 1190725 1190725 0.00
crit 15.85 17.87% 32703.02 31970 35167 32704.82 31970 34811 518238 518238 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 2917 8.0% 17.9 16.61sec 48690 47427 Direct 17.9 4194 8388 4957 18.2%  
Periodic 219.5 3027 6049 3569 17.9% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.91 17.91 219.49 219.49 1.0267 1.3451 872092.34 872092.34 0.00 2780.61 47427.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.65 81.82% 4194.48 3637 5255 4195.37 3944 4593 61469 61469 0.00
crit 3.26 18.18% 8387.62 7141 10511 8145.75 0 10511 27313 27313 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.1 82.07% 3026.86 2 3810 3028.26 2948 3167 545276 545276 0.00
crit 39.3 17.93% 6049.45 9 7620 6052.26 5561 6553 238036 238036 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.44sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 183.16sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9041 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Worldvein Resonance 5.5 60.37sec

Stats details: worldvein_resonance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.46 0.00 0.00 0.00 1.1471 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: worldvein_resonance

Static Values
  • id:295186
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295186
  • name:Worldvein Resonance
  • school:physical
  • tooltip:
  • description:Concentrate energy into the Heart of Azeroth, immediately causing {$s1=2} Lifeblood Shards to erupt from the nearby ground for {$295114d=12 seconds}. $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within {$295078s2=8} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.1 53.0 44.7sec 5.0sec 92.84% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.33%
  • arcanic_pulsar_2:10.29%
  • arcanic_pulsar_3:11.28%
  • arcanic_pulsar_4:10.63%
  • arcanic_pulsar_5:13.77%
  • arcanic_pulsar_6:10.34%
  • arcanic_pulsar_7:10.86%
  • arcanic_pulsar_8:14.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 189.1sec 0.0sec 16.25% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.4sec 182.4sec 8.13% 7.78% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.54% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.54%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.6sec 37.6sec 25.78% 32.54% 0.0(0.0) 8.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.7sec 45.2sec 23.69% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:868.01

Stack Uptimes

  • conch_of_dark_whispers_1:23.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.20% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:347.73

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 93.9 0.0 153.9sec 3.2sec 99.98% 0.00% 84.2(97.5) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:190.14

Stack Uptimes

  • lifeblood_1:0.10%
  • lifeblood_2:0.83%
  • lifeblood_3:5.84%
  • lifeblood_4:93.21%

Trigger Attempt Success

  • trigger_pct:94.37%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.6 45.2 9.0sec 3.8sec 81.87% 99.68% 1.8(1.8) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.33%
  • lunar_empowerment_2:31.48%
  • lunar_empowerment_3:14.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Overwhelming Power 4.5 3.4 64.5sec 34.2sec 47.58% 0.00% 3.4(47.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.57%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.75%
  • overwhelming_power_11:1.80%
  • overwhelming_power_12:1.85%
  • overwhelming_power_13:1.91%
  • overwhelming_power_14:1.96%
  • overwhelming_power_15:2.02%
  • overwhelming_power_16:2.08%
  • overwhelming_power_17:2.14%
  • overwhelming_power_18:2.21%
  • overwhelming_power_19:2.27%
  • overwhelming_power_20:2.34%
  • overwhelming_power_21:2.41%
  • overwhelming_power_22:2.48%
  • overwhelming_power_23:2.56%
  • overwhelming_power_24:2.63%
  • overwhelming_power_25:1.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.4 51.0 12.1sec 4.0sec 85.65% 79.77% 0.2(0.2) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.18%
  • solar_empowerment_2:39.61%
  • solar_empowerment_3:17.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.2 20.3sec 5.0sec 97.02% 92.01% 15.3(15.3) 11.4

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.90%
  • starlord_2:22.45%
  • starlord_3:59.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.5sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.65%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Battle-Scarred Augmentation

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast)

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 60.3 2413.3 40.0 40.0 1541.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 92.22 737.73 (31.05%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.37%) 40.00 0.00 0.00%
sunfire Astral Power 17.91 53.73 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 43.89 175.55 (7.39%) 4.00 0.01 0.01%
moonfire Astral Power 14.05 42.16 (1.77%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.71 101.72 (4.28%) 8.00 0.00 0.00%
lunar_strike Astral Power 75.91 910.81 (38.34%) 12.00 0.06 0.01%
natures_balance Astral Power 399.62 199.81 (8.41%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.18 74.22 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 7.94 8.06
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.76 0.00 88.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data worldvein Damage Per Second
Count 7672
Mean 36722.31
Minimum 32879.76
Maximum 41781.21
Spread ( max - min ) 8901.45
Range [ ( max - min ) / 2 * 100% ] 12.12%
Standard Deviation 1138.1117
5th Percentile 34929.47
95th Percentile 38681.94
( 95th Percentile - 5th Percentile ) 3752.48
Mean Distribution
Standard Deviation 12.9936
95.00% Confidence Intervall ( 36696.84 - 36747.77 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3690
0.1 Scale Factor Error with Delta=300 11058
0.05 Scale Factor Error with Delta=300 44230
0.01 Scale Factor Error with Delta=300 1105742
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 7672
Mean 36722.31
Minimum 32879.76
Maximum 41781.21
Spread ( max - min ) 8901.45
Range [ ( max - min ) / 2 * 100% ] 12.12%
Standard Deviation 1138.1117
5th Percentile 34929.47
95th Percentile 38681.94
( 95th Percentile - 5th Percentile ) 3752.48
Mean Distribution
Standard Deviation 12.9936
95.00% Confidence Intervall ( 36696.84 - 36747.77 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3690
0.1 Scale Factor Error with Delta=300 11058
0.05 Scale Factor Error with Delta=300 44230
0.01 Scale Factor Error with Delta=300 1105742
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 7672
Mean 36722.31
Minimum 32879.76
Maximum 41781.21
Spread ( max - min ) 8901.45
Range [ ( max - min ) / 2 * 100% ] 12.12%
Damage
Sample Data worldvein Damage
Count 7672
Mean 10968447.29
Minimum 8604933.32
Maximum 13373626.49
Spread ( max - min ) 4768693.17
Range [ ( max - min ) / 2 * 100% ] 21.74%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 guardian_of_azeroth
0.00 concentrated_flame
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
H 5.46 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.77 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.33 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.06 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.49 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.27 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.71 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 76.27 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 91.47 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQRKRQRQKRNRQORQRKPKRLQKQQQRRRQRKRKRQRQRJKKNOQPRQRQKRQQKRQHKNORQKRPQQKRQQNJKRKRQKMRQKRQPQNRQRKKRQOQKRQRKQNQPRRHKQKGRQKRQMRRKNQRRRQRRPKKQQKRONQRKRQQRRRRKKPQNQKRQKRQMRQHRRKQIEFKNKPRQRKORQRKRQRQRQKLKQRQQRKPRQKRMQNQRKRKRQKRQQRKOPHNRQGRKQRKQRRKQQRRRRK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H worldvein_resonance Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.247 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lifeblood(3), battle_potion_of_intellect
0:02.208 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:03.140 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.074 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.007 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.818 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.818 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.818 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.570 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.325 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.078 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:08.831 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:09.684 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse
0:10.437 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.191 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.947 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.768 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.522 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.342 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.097 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.852 default N sunfire Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.607 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.364 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.153 default O moonfire Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.907 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.662 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.500 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.254 default K starsurge Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.009 default P stellar_flare Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.761 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.515 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), lifeblood(4), ignition_mages_fuse(5)
0:24.270 default L sunfire Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(4), ignition_mages_fuse(5)
0:25.025 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse(5)
0:25.978 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4)
0:26.885 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
0:28.008 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
0:29.133 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
0:30.257 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
0:31.011 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:31.765 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood(4)
0:32.648 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
0:33.771 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(4)
0:34.575 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(4)
0:35.384 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(4)
0:36.138 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(4)
0:36.892 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(4)
0:37.647 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4)
0:38.553 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood(4)
0:39.307 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(4)
0:40.201 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(4)
0:40.957 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(4)
0:40.957 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(24), lifeblood(4)
0:41.724 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(23), lifeblood(4)
0:42.839 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), lifeblood(4)
0:43.927 default O moonfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), lifeblood(4)
0:45.018 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), lifeblood(4)
0:46.417 default P stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(18), lifeblood(4)
0:47.520 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(17), lifeblood(4)
0:48.461 default Q lunar_strike Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), lifeblood(4)
0:49.876 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(15), lifeblood(4)
0:50.824 default Q lunar_strike Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(14), lifeblood(4)
0:52.251 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(12), lifeblood(4)
0:53.377 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(11), lifeblood(4)
0:54.310 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood(4)
0:55.715 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), lifeblood(4)
0:57.126 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), lifeblood(4)
0:58.242 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(6), lifeblood(4)
0:59.193 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), lifeblood(4)
1:00.625 default H worldvein_resonance Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), lifeblood(4)
1:01.753 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), overwhelming_power(3), lifeblood(4)
1:02.986 default N sunfire Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(2), lifeblood(4)
1:04.190 default O moonfire Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, lifeblood(4)
1:05.402 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, lifeblood(4)
1:06.432 default Q lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, lifeblood(4)
1:07.977 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
1:09.191 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), lifeblood(4)
1:10.193 default P stellar_flare Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), lifeblood(4)
1:11.371 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), lifeblood(4)
1:12.871 default Q lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
1:14.372 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
1:15.550 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4)
1:16.524 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
1:17.983 default Q lunar_strike Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:19.443 default N sunfire Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), lifeblood(4)
1:20.589 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(3), lifeblood(4)
1:20.589 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), solar_empowerment(3), lifeblood(4)
1:21.836 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4)
1:22.731 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
1:23.784 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), lifeblood(4)
1:24.657 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
1:25.964 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
1:26.989 default M moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4)
1:27.984 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4)
1:28.958 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
1:30.417 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:31.563 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(4)
1:32.537 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(4)
1:33.998 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:35.143 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
1:36.603 default N sunfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
1:37.747 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
1:38.721 default Q lunar_strike Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers
1:40.182 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
1:41.155 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(3), solar_empowerment, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
1:42.404 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, lifeblood(4), conch_of_dark_whispers
1:43.618 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
1:44.619 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(4), conch_of_dark_whispers
1:46.120 default O moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2), conch_of_dark_whispers
1:47.298 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(2), conch_of_dark_whispers
1:48.798 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(3), conch_of_dark_whispers
1:49.975 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(3), conch_of_dark_whispers
1:50.865 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(3), conch_of_dark_whispers
1:52.202 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood(4)
1:53.100 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4)
1:54.160 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood(4)
1:55.518 default N sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(19), lifeblood(4)
1:56.588 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4)
1:57.956 default P stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood(4)
1:59.034 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood(4)
1:59.959 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(15), lifeblood(4)
2:00.882 default H worldvein_resonance Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(14), lifeblood(4)
2:01.971 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(7), overwhelming_power(13), lifeblood(4)
2:03.160 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), lifeblood(4)
2:04.641 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(10), lifeblood(4)
2:05.809 default G use_items Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4)
2:05.809 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), lifeblood(4), ignition_mages_fuse
2:06.620 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(25), lifeblood(4), ignition_mages_fuse
2:07.767 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(24), lifeblood(4), ignition_mages_fuse
2:08.672 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4), ignition_mages_fuse
2:09.425 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(4), ignition_mages_fuse
2:10.551 default M moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4), ignition_mages_fuse(2)
2:11.410 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4), ignition_mages_fuse(2)
2:12.248 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(19), lifeblood(4), ignition_mages_fuse(2)
2:13.091 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar, starlord(3), overwhelming_power(18), lifeblood(4), ignition_mages_fuse(2)
2:14.085 default N sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), lifeblood(4), ignition_mages_fuse(3)
2:15.047 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4), ignition_mages_fuse(3)
2:16.274 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood(4), ignition_mages_fuse(3)
2:17.099 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse(3)
2:17.924 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse(4)
2:18.861 default Q lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(13), lifeblood(4), ignition_mages_fuse(4)
2:20.058 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(11), lifeblood(4), ignition_mages_fuse(4)
2:21.004 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(10), lifeblood(4), ignition_mages_fuse(4)
2:21.953 default P stellar_flare Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(10), lifeblood(4), ignition_mages_fuse(5)
2:22.873 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(2), overwhelming_power(9), lifeblood(4), ignition_mages_fuse(5)
2:23.877 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), lifeblood(4), ignition_mages_fuse(5)
2:24.854 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(7), lifeblood(4), ignition_mages_fuse(5)
2:26.066 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), lifeblood(4), conch_of_dark_whispers
2:27.538 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(4), lifeblood(4), conch_of_dark_whispers
2:28.699 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), lifeblood(4), conch_of_dark_whispers
2:29.662 default O moonfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), lifeblood(4), conch_of_dark_whispers
2:30.801 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, lifeblood(4), conch_of_dark_whispers
2:31.942 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
2:33.403 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), lifeblood(4), conch_of_dark_whispers
2:34.376 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
2:35.521 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood(2), conch_of_dark_whispers
2:36.493 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood(2), conch_of_dark_whispers
2:37.952 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(3), conch_of_dark_whispers
2:39.413 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), lifeblood(4), conch_of_dark_whispers
2:40.387 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), lifeblood(4), conch_of_dark_whispers
2:41.361 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), lifeblood(4)
2:42.333 default R solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), starlord(3), lifeblood(4)
2:43.475 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(6), lifeblood(4)
2:44.723 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, lifeblood(4)
2:45.935 default P stellar_flare Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
2:47.113 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood(4)
2:48.613 default N sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
2:49.789 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(4)
2:51.290 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), lifeblood(4)
2:52.468 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
2:53.315 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
2:54.584 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, solar_empowerment(2), starlord(3), lifeblood(4)
2:55.580 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(4)
2:56.429 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(4)
2:57.701 default M moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
2:58.696 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4)
2:59.671 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
3:01.130 default H worldvein_resonance Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
3:02.276 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4)
3:03.250 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood(4)
3:04.300 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(23), lifeblood(4)
3:05.449 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22), lifeblood(4)
3:06.876 default I celestial_alignment Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), lifeblood(4)
3:07.856 default E potion Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), lifeblood(4)
3:07.856 default F berserking Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), lifeblood(4), battle_potion_of_intellect
3:07.856 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), lifeblood(4), battle_potion_of_intellect
3:08.747 default N sunfire Fluffy_Pillow 51.5/100: 52% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), lifeblood(4), battle_potion_of_intellect
3:09.618 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), lifeblood(4), battle_potion_of_intellect
3:10.490 default P stellar_flare Fluffy_Pillow 15.5/100: 16% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), lifeblood(4), battle_potion_of_intellect
3:11.341 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(16), lifeblood(4), battle_potion_of_intellect
3:12.096 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood(4), battle_potion_of_intellect
3:13.190 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(4), battle_potion_of_intellect
3:13.945 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(4), battle_potion_of_intellect
3:14.807 default O moonfire Fluffy_Pillow 14.5/100: 14% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood(4), battle_potion_of_intellect
3:15.670 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), lifeblood(4), battle_potion_of_intellect
3:16.423 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), lifeblood(4), battle_potion_of_intellect
3:17.531 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), lifeblood(4), battle_potion_of_intellect
3:18.285 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), lifeblood(4), battle_potion_of_intellect
3:19.161 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), lifeblood(4), battle_potion_of_intellect
3:19.915 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood(4), battle_potion_of_intellect
3:21.076 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:21.994 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood(4), battle_potion_of_intellect
3:23.161 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4), battle_potion_of_intellect
3:23.946 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), lifeblood(4), battle_potion_of_intellect
3:25.123 default K starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, torrent_of_elements, overwhelming_power(19), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:26.136 default L sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(18), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:27.124 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:28.265 default Q lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(16), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:29.681 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(15), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:30.630 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(14), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:32.055 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(12), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:33.491 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(11), lifeblood(4), conch_of_dark_whispers
3:34.454 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(10), lifeblood(4), conch_of_dark_whispers
3:35.588 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(9), lifeblood(4), conch_of_dark_whispers
3:36.551 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), lifeblood(4), conch_of_dark_whispers
3:37.373 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), lifeblood(4), conch_of_dark_whispers
3:38.609 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6), lifeblood(4), conch_of_dark_whispers
3:39.584 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(5), lifeblood(4), conch_of_dark_whispers
3:40.414 default M moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(4), lifeblood(4)
3:41.397 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3), lifeblood(3)
3:42.839 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), lifeblood(4)
3:43.976 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, lifeblood(4)
3:45.429 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar, solar_empowerment(3), lifeblood(4)
3:46.491 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar, solar_empowerment(2), lifeblood(4)
3:47.740 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4)
3:48.770 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
3:49.982 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), lifeblood(4)
3:50.983 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(25), lifeblood(4)
3:52.355 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), lifeblood(4)
3:53.439 default R solar_wrath Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(22), lifeblood(4)
3:54.338 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(21), lifeblood(4)
3:55.689 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4)
3:57.045 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(18), lifeblood(4)
3:57.957 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(18), lifeblood(4)
3:59.029 default O moonfire Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), lifeblood(4)
4:00.109 default P stellar_flare Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(15), lifeblood(4)
4:01.192 default H worldvein_resonance Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14), lifeblood(4)
4:02.279 default N sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), lifeblood(4)
4:03.371 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12), lifeblood(4)
4:04.304 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), lifeblood(4)
4:05.707 default G use_items Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood(4)
4:05.707 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood(4), ignition_mages_fuse
4:06.609 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), solar_empowerment, overwhelming_power(9), lifeblood(4), ignition_mages_fuse
4:07.770 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(8), lifeblood(4), ignition_mages_fuse
4:09.211 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(24), lifeblood(4), ignition_mages_fuse
4:10.120 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(23), lifeblood(4), ignition_mages_fuse(2)
4:11.155 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(22), lifeblood(4), ignition_mages_fuse(2)
4:12.441 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(21), lifeblood(4), ignition_mages_fuse(2)
4:13.301 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(20), lifeblood(4), ignition_mages_fuse(2)
4:14.162 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(2), overwhelming_power(19), lifeblood(4), ignition_mages_fuse(3)
4:15.145 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), lifeblood(4), ignition_mages_fuse(3)
4:16.367 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), lifeblood(4), ignition_mages_fuse(3)
4:17.593 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(16), lifeblood(4), ignition_mages_fuse(3)
4:18.414 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), lifeblood(4), ignition_mages_fuse(4)
4:19.349 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), lifeblood(4), ignition_mages_fuse(4)
4:20.288 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13), lifeblood(4), ignition_mages_fuse(4)
4:21.229 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12), lifeblood(4), ignition_mages_fuse(4)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 13657 12416 11415
Intellect 1467 -3 11723 10239 8288 (5117)
Spirit 0 0 0 0 0
Health 273140 248320 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 11723 10239 0
Crit 15.10% 15.10% 727
Melee Haste 20.54% 20.54% 1397
Spell Haste 20.54% 20.54% 1397
Damage / Heal Versatility 4.58% 4.58% 389
ManaReg per Second 2371 640 0
Attack Power 12192 10649 0
Mastery 53.75% 53.75% 1937
Armor 2599 2599 2599
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 431.00
Local Head Hood of the Slithering Loa
ilevel: 430, stats: { 349 Armor, +950 AgiInt, +1820 Sta }
Local Neck Heart of Azeroth
ilevel: 443, stats: { +305 Haste, +305 Crit, +305 Mastery, +580 Sta, +317 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 430, stats: { 322 Armor, +713 AgiInt, +1366 Sta }
Local Chest Spymaster's Wrap
ilevel: 430, stats: { 430 Armor, +950 AgiInt, +1820 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 430, stats: { 242 Armor, +375 AgiInt, +673 Sta, +140 Mastery, +77 Crit }
Local Legs Leggings of the Stormborn
ilevel: 430, stats: { 376 Armor, +500 AgiInt, +897 Sta, +170 Vers, +120 Crit }
Local Feet Ancient Tempest Striders
ilevel: 430, stats: { 296 Armor, +375 AgiInt, +673 Sta, +127 Mastery, +90 Haste }
Local Wrists Tideblood Bracers
ilevel: 430, stats: { 188 Armor, +281 AgiInt, +504 Sta, +100 Haste, +63 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 430, stats: { 269 Armor, +375 AgiInt, +673 Sta, +127 Haste, +90 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 430, stats: { +504 Sta, +350 Mastery, +160 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 430, stats: { +504 Sta, +292 Haste, +219 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 430, stats: { +475 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 430, stats: { +475 Int }
Local Back Cloak of Ill Tidings
ilevel: 430, stats: { 127 Armor, +281 StrAgiInt, +504 Sta, +105 Mastery, +58 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 430, weapon: { 575 - 780, 3.6 }, stats: { +500 Int, +897 Sta, +104 Haste, +104 Crit, +104 Mastery, +1721 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/guardian_of_azeroth
actions+=/concentrated_flame
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=430
neck=heart_of_azeroth,id=158075,ilevel=443
shoulders=gorak_tuls_mantle,id=159339,ilevel=430
back=cloak_of_ill_tidings,id=168391,ilevel=430
chest=spymasters_wrap,id=155860,ilevel=430
wrists=tideblood_bracers,id=168377,ilevel=430
hands=gloves_of_incomparable_beauty,id=168887,ilevel=430
waist=beloved_monarchs_waistwrap,id=168871,ilevel=430
legs=leggings_of_the_stormborn,id=168378,ilevel=430
feet=ancient_tempest_striders,id=168380,ilevel=430
finger1=boralus_nobles_seal,id=168889,ilevel=430,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=430,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=430
trinket2=conch_of_dark_whispers,id=159620,ilevel=430
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=430,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=430.87
# gear_stamina=11415
# gear_intellect=8288
# gear_crit_rating=727
# gear_haste_rating=1298
# gear_mastery_rating=1221
# gear_versatility_rating=389
# gear_armor=2599

Simulation & Raid Information

Iterations: 7678
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.3 )

Performance:

Total Events Processed: 215436180
Max Event Queue: 391
Sim Seconds: 2298329
CPU Seconds: 405.5625
Physical Seconds: 138.0377
Speed Up: 5667

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 299.34sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.60sec 0 299.34sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
base base heed_my_call 271685 87218 291 1.63 9105 18202 8.1 8.1 17.7% 0.0% 0.0% 0.0% 33.15sec 87218 299.34sec
base base heed_my_call_aoe 271686 37453 125 1.63 3902 7805 8.1 8.1 17.9% 0.0% 0.0% 0.0% 33.15sec 37453 299.34sec
base base lunar_strike 194153 1517773 5070 15.56 16572 33121 77.6 77.6 18.0% 0.0% 0.0% 0.0% 3.77sec 1517773 299.34sec
base base moonfire 8921 47306 158 2.81 2860 5719 14.0 14.0 17.9% 0.0% 0.0% 0.0% 21.41sec 733912 299.34sec
base base moonfire ticks -8921 686606 2289 44.29 2630 5255 14.0 221.5 17.9% 0.0% 0.0% 0.0% 21.41sec 733912 299.34sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
base base shooting_stars 202497 238320 796 8.88 4565 9113 44.3 44.3 17.9% 0.0% 0.0% 0.0% 6.56sec 238320 299.34sec
base base solar_wrath 190984 851917 2846 18.98 7634 15258 94.2 94.7 17.9% 0.0% 0.0% 0.0% 3.12sec 851917 299.34sec
base base solar_empowerment 279729 492114 1644 14.97 6591 0 74.7 74.7 0.0% 0.0% 0.0% 0.0% 3.92sec 492114 299.34sec
base base starsurge 78674 3560646 11895 12.29 49252 98387 61.5 61.3 17.9% 0.0% 0.0% 0.0% 4.91sec 3560646 299.34sec
base base stellar_flare 202347 36461 122 2.56 2424 4849 12.8 12.8 17.9% 0.0% 0.0% 0.0% 23.57sec 476747 299.34sec
base base stellar_flare ticks -202347 440286 1468 43.83 1704 3406 12.8 219.1 17.9% 0.0% 0.0% 0.0% 23.57sec 476747 299.34sec
base base streaking_stars 272873 1732976 5789 18.03 16342 32700 90.0 90.0 17.9% 0.0% 0.0% 0.0% 3.10sec 1732976 299.34sec
base base sunfire 93402 82208 275 3.57 3915 7818 17.8 17.8 17.9% 0.0% 0.0% 0.0% 16.75sec 816838 299.34sec
base base sunfire ticks -93402 734630 2449 44.12 2825 5646 17.8 220.6 17.9% 0.0% 0.0% 0.0% 16.75sec 816838 299.34sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.57sec 0 299.34sec
blood of the enemy blood of the enemy blood_of_the_enemy 297108 108178 361 0.74 22901 57286 3.7 3.7 19.0% 0.0% 0.0% 0.0% 91.20sec 108178 299.34sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.73sec 0 299.34sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
blood of the enemy blood of the enemy heed_my_call 271685 92568 309 1.65 9108 18716 8.2 8.2 22.1% 0.0% 0.0% 0.0% 32.75sec 92568 299.34sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 39766 133 1.65 3903 8016 8.2 8.2 22.4% 0.0% 0.0% 0.0% 32.75sec 39766 299.34sec
blood of the enemy blood of the enemy lunar_strike 194153 1562543 5220 15.46 16499 33959 77.1 77.1 21.6% 0.0% 0.0% 0.0% 3.79sec 1562543 299.34sec
blood of the enemy blood of the enemy moonfire 8921 49351 165 2.81 2847 5932 14.0 14.0 21.7% 0.0% 0.0% 0.0% 21.41sec 779165 299.34sec
blood of the enemy blood of the enemy moonfire ticks -8921 729814 2433 44.70 2617 5512 14.0 223.5 22.4% 0.0% 0.0% 0.0% 21.41sec 779165 299.34sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
blood of the enemy blood of the enemy shooting_stars 202497 252526 844 8.94 4541 9548 44.6 44.6 22.4% 0.0% 0.0% 0.0% 6.54sec 252526 299.34sec
blood of the enemy blood of the enemy solar_wrath 190984 884636 2955 18.88 7588 15695 93.7 94.2 22.2% 0.0% 0.0% 0.0% 3.13sec 884636 299.34sec
blood of the enemy blood of the enemy solar_empowerment 279729 514833 1720 14.90 6928 0 74.3 74.3 0.0% 0.0% 0.0% 0.0% 3.94sec 514833 299.34sec
blood of the enemy blood of the enemy starsurge 78674 3750149 12528 12.25 48967 103756 61.3 61.1 22.7% 0.0% 0.0% 0.0% 4.92sec 3750149 299.34sec
blood of the enemy blood of the enemy stellar_flare 202347 38256 128 2.56 2409 5122 12.8 12.8 21.7% 0.0% 0.0% 0.0% 23.57sec 506294 299.34sec
blood of the enemy blood of the enemy stellar_flare ticks -202347 468039 1560 44.23 1696 3573 12.8 221.1 22.4% 0.0% 0.0% 0.0% 23.57sec 506294 299.34sec
blood of the enemy blood of the enemy streaking_stars 272873 1860497 6215 17.76 16355 34117 88.6 88.6 26.2% 0.0% 0.0% 0.0% 3.14sec 1860497 299.34sec
blood of the enemy blood of the enemy sunfire 93402 85211 285 3.57 3902 8036 17.8 17.8 21.2% 0.0% 0.0% 0.0% 16.74sec 864859 299.34sec
blood of the enemy blood of the enemy sunfire ticks -93402 779648 2599 44.53 2811 5907 17.8 222.7 22.3% 0.0% 0.0% 0.0% 16.74sec 864859 299.34sec
crucible of flame crucible of flame ancient_flame ticks -295367 375369 1251 17.94 3545 7094 24.9 89.7 18.0% 0.0% 0.0% 0.0% 11.71sec 375369 299.34sec
crucible of flame crucible of flame augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
crucible of flame crucible of flame berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.45sec 0 299.34sec
crucible of flame crucible of flame celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.47sec 0 299.34sec
crucible of flame crucible of flame concentrated_flame 295373 0 0 0.00 0 0 11.5 0.0 0.0% 0.0% 0.0% 0.0% 29.90sec 0 299.34sec
crucible of flame crucible of flame concentrated_flame_missile 295374 340790 1138 2.30 25118 50972 11.5 11.5 17.8% 0.0% 0.0% 0.0% 29.90sec 340790 299.34sec
crucible of flame crucible of flame concentrated_flame_burn ticks -295368 221691 739 6.40 6928 0 11.5 32.0 0.0% 0.0% 0.0% 0.0% 29.90sec 221691 299.34sec
crucible of flame crucible of flame flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
crucible of flame crucible of flame food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
crucible of flame crucible of flame heed_my_call 271685 87909 294 1.64 9109 18221 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.28sec 87909 299.34sec
crucible of flame crucible of flame heed_my_call_aoe 271686 37692 126 1.64 3904 7807 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.28sec 37692 299.34sec
crucible of flame crucible of flame lunar_strike 194153 1449841 4843 14.83 16599 33168 74.0 74.0 18.1% 0.0% 0.0% 0.0% 3.93sec 1449841 299.34sec
crucible of flame crucible of flame moonfire 8921 47164 158 2.81 2849 5694 14.0 14.0 17.9% 0.0% 0.0% 0.0% 21.26sec 726867 299.34sec
crucible of flame crucible of flame moonfire ticks -8921 679703 2266 43.88 2626 5247 14.0 219.4 18.0% 0.0% 0.0% 0.0% 21.26sec 726867 299.34sec
crucible of flame crucible of flame moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
crucible of flame crucible of flame potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
crucible of flame crucible of flame shooting_stars 202497 235308 786 8.77 4558 9112 43.8 43.8 18.0% 0.0% 0.0% 0.0% 6.62sec 235308 299.34sec
crucible of flame crucible of flame solar_wrath 190984 803555 2684 17.86 7644 15282 88.6 89.1 18.0% 0.0% 0.0% 0.0% 3.30sec 803555 299.34sec
crucible of flame crucible of flame solar_empowerment 279729 471908 1576 14.33 6601 0 71.5 71.5 0.0% 0.0% 0.0% 0.0% 4.07sec 471908 299.34sec
crucible of flame crucible of flame starsurge 78674 3426813 11448 11.82 49253 98410 59.2 59.0 18.0% 0.0% 0.0% 0.0% 5.07sec 3426813 299.34sec
crucible of flame crucible of flame stellar_flare 202347 35348 118 2.54 2369 4738 12.7 12.7 17.8% 0.0% 0.0% 0.0% 23.58sec 471054 299.34sec
crucible of flame crucible of flame stellar_flare ticks -202347 435706 1452 43.41 1702 3402 12.7 217.1 18.0% 0.0% 0.0% 0.0% 23.58sec 471054 299.34sec
crucible of flame crucible of flame streaking_stars 272873 1652073 5519 17.17 16354 32708 85.7 85.7 17.9% 0.0% 0.0% 0.0% 3.23sec 1652073 299.34sec
crucible of flame crucible of flame sunfire 93402 81414 272 3.54 3905 7806 17.7 17.7 18.0% 0.0% 0.0% 0.0% 16.80sec 808680 299.34sec
crucible of flame crucible of flame sunfire ticks -93402 727266 2424 43.72 2821 5637 17.7 218.6 18.0% 0.0% 0.0% 0.0% 16.80sec 808680 299.34sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 299.34sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.46sec 0 299.34sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
focusing iris focusing iris heed_my_call 271685 91025 304 1.70 9106 18219 8.5 8.5 18.1% 0.0% 0.0% 0.0% 32.13sec 91025 299.34sec
focusing iris focusing iris heed_my_call_aoe 271686 39060 130 1.70 3903 7803 8.5 8.5 18.2% 0.0% 0.0% 0.0% 32.13sec 39060 299.34sec
focusing iris focusing iris lunar_strike 194153 1579038 5275 16.17 16587 33154 80.7 80.7 18.0% 0.0% 0.0% 0.0% 3.63sec 1579038 299.34sec
focusing iris focusing iris moonfire 8921 47544 159 2.83 2855 5703 14.1 14.1 17.9% 0.0% 0.0% 0.0% 21.35sec 762432 299.34sec
focusing iris focusing iris moonfire ticks -8921 714888 2383 46.08 2633 5260 14.1 230.4 17.9% 0.0% 0.0% 0.0% 21.35sec 762432 299.34sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
focusing iris focusing iris shooting_stars 202497 247932 828 9.23 4568 9122 46.0 46.0 18.0% 0.0% 0.0% 0.0% 6.35sec 247932 299.34sec
focusing iris focusing iris solar_wrath 190984 899214 3004 20.00 7644 15276 99.3 99.8 17.9% 0.0% 0.0% 0.0% 2.96sec 899214 299.34sec
focusing iris focusing iris solar_empowerment 279729 511904 1710 15.54 6605 0 77.5 77.5 0.0% 0.0% 0.0% 0.0% 3.78sec 511904 299.34sec
focusing iris focusing iris starsurge 78674 3686715 12316 12.73 49280 98497 63.7 63.5 17.8% 0.0% 0.0% 0.0% 4.74sec 3686715 299.34sec
focusing iris focusing iris stellar_flare 202347 36527 122 2.56 2429 4853 12.8 12.8 17.8% 0.0% 0.0% 0.0% 23.56sec 495397 299.34sec
focusing iris focusing iris stellar_flare ticks -202347 458870 1530 45.62 1706 3410 12.8 228.1 17.9% 0.0% 0.0% 0.0% 23.56sec 495397 299.34sec
focusing iris focusing iris streaking_stars 272873 1801632 6019 18.74 16351 32704 93.5 93.5 17.8% 0.0% 0.0% 0.0% 3.00sec 1801632 299.34sec
focusing iris focusing iris sunfire 93402 80899 270 3.51 3913 7820 17.5 17.5 18.0% 0.0% 0.0% 0.0% 17.08sec 846698 299.34sec
focusing iris focusing iris sunfire ticks -93402 765799 2553 45.93 2828 5651 17.5 229.7 18.0% 0.0% 0.0% 0.0% 17.08sec 846698 299.34sec
life-force life-force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
life-force life-force azerite_spike 295835 215693 721 3.29 11145 22295 16.5 16.4 17.8% 0.0% 0.0% 0.0% 17.45sec 215693 299.34sec
life-force life-force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.69sec 0 299.34sec
life-force life-force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.70sec 0 299.34sec
life-force life-force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
life-force life-force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
life-force life-force guardian_of_azeroth 295840 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
life-force life-force heed_my_call 271685 89979 301 1.64 9317 18626 8.2 8.2 18.1% 0.0% 0.0% 0.0% 33.23sec 89979 299.34sec
life-force life-force heed_my_call_aoe 271686 38493 129 1.64 3992 7989 8.2 8.2 17.9% 0.0% 0.0% 0.0% 33.23sec 38493 299.34sec
life-force life-force lunar_strike 194153 1541578 5150 15.44 16966 33907 77.0 77.0 18.0% 0.0% 0.0% 0.0% 3.79sec 1541578 299.34sec
life-force life-force moonfire 8921 48299 161 2.81 2923 5847 14.0 14.0 18.0% 0.0% 0.0% 0.0% 21.38sec 748985 299.34sec
life-force life-force moonfire ticks -8921 700686 2336 44.10 2694 5388 14.0 220.5 17.9% 0.0% 0.0% 0.0% 21.38sec 748985 299.34sec
life-force life-force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
life-force life-force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
life-force life-force shooting_stars 202497 242734 811 8.82 4676 9348 44.0 44.0 17.9% 0.0% 0.0% 0.0% 6.63sec 242734 299.34sec
life-force life-force solar_wrath 190984 862346 2881 18.75 7821 15626 93.0 93.6 17.9% 0.0% 0.0% 0.0% 3.15sec 862346 299.34sec
life-force life-force solar_empowerment 279729 500541 1672 14.85 6755 0 74.1 74.1 0.0% 0.0% 0.0% 0.0% 3.93sec 500541 299.34sec
life-force life-force starsurge 78674 3620280 12094 12.20 50465 100795 61.1 60.9 17.9% 0.0% 0.0% 0.0% 4.93sec 3620280 299.34sec
life-force life-force stellar_flare 202347 37068 124 2.55 2474 4938 12.7 12.7 17.9% 0.0% 0.0% 0.0% 23.57sec 486220 299.34sec
life-force life-force stellar_flare ticks -202347 449152 1497 43.64 1746 3489 12.7 218.2 18.0% 0.0% 0.0% 0.0% 23.57sec 486220 299.34sec
life-force life-force streaking_stars 272873 1785551 5965 17.93 16928 33844 89.4 89.4 18.0% 0.0% 0.0% 0.0% 3.10sec 1785551 299.34sec
life-force life-force sunfire 93402 84834 283 3.59 4017 8025 17.9 17.9 17.9% 0.0% 0.0% 0.0% 16.63sec 834417 299.34sec
life-force life-force sunfire ticks -93402 749584 2499 43.94 2894 5783 17.9 219.7 17.9% 0.0% 0.0% 0.0% 16.63sec 834417 299.34sec
life-force life-force_guardian_of_azeroth azerite_spike 295856 438210 7303 53.80 6927 13853 53.8 53.8 17.6% 0.0% 0.0% 0.0% 3.94sec 438210 60.00sec
life-force life-force_guardian_of_azeroth azerite_volley 303351 61308 1022 6.00 8658 17316 6.0 6.0 18.0% 0.0% 0.0% 0.0% 39.27sec 61308 60.00sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 181.89sec 0 299.34sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.86sec 0 299.34sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
lucid dreams lucid dreams heed_my_call 271685 88882 297 1.64 9201 18410 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.14sec 88882 299.34sec
lucid dreams lucid dreams heed_my_call_aoe 271686 38144 127 1.64 3944 7887 8.2 8.2 18.1% 0.0% 0.0% 0.0% 33.14sec 38144 299.34sec
lucid dreams lucid dreams lunar_strike 194153 1504910 5027 15.27 16750 33488 76.2 76.2 18.0% 0.0% 0.0% 0.0% 3.83sec 1504910 299.34sec
lucid dreams lucid dreams memory_of_lucid_dreams 298357 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.02sec 0 299.34sec
lucid dreams lucid dreams moonfire 8921 47718 159 2.84 2860 5713 14.1 14.1 18.0% 0.0% 0.0% 0.0% 21.25sec 746363 299.34sec
lucid dreams lucid dreams moonfire ticks -8921 698645 2329 44.41 2667 5331 14.1 222.0 18.0% 0.0% 0.0% 0.0% 21.25sec 746363 299.34sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
lucid dreams lucid dreams shooting_stars 202497 241950 808 8.88 4627 9245 44.3 44.3 18.1% 0.0% 0.0% 0.0% 6.57sec 241950 299.34sec
lucid dreams lucid dreams solar_wrath 190984 773994 2586 16.96 7760 15513 84.0 84.6 17.9% 0.0% 0.0% 0.0% 3.48sec 773994 299.34sec
lucid dreams lucid dreams solar_empowerment 279729 536349 1792 16.05 6697 0 80.1 80.1 0.0% 0.0% 0.0% 0.0% 3.64sec 536349 299.34sec
lucid dreams lucid dreams starsurge 78674 4236538 14153 14.39 49997 99912 72.1 71.8 18.1% 0.0% 0.0% 0.0% 4.20sec 4236538 299.34sec
lucid dreams lucid dreams stellar_flare 202347 36754 123 2.56 2446 4898 12.7 12.7 17.8% 0.0% 0.0% 0.0% 23.58sec 484926 299.34sec
lucid dreams lucid dreams stellar_flare ticks -202347 448172 1494 43.96 1729 3456 12.7 219.8 17.9% 0.0% 0.0% 0.0% 23.58sec 484926 299.34sec
lucid dreams lucid dreams streaking_stars 272873 1889711 6313 19.38 16560 33137 96.7 96.7 18.0% 0.0% 0.0% 0.0% 2.90sec 1889711 299.34sec
lucid dreams lucid dreams sunfire 93402 81527 272 3.49 3972 7935 17.4 17.4 17.9% 0.0% 0.0% 0.0% 17.17sec 828151 299.34sec
lucid dreams lucid dreams sunfire ticks -93402 746624 2489 44.23 2863 5722 17.4 221.2 17.9% 0.0% 0.0% 0.0% 17.17sec 828151 299.34sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.49sec 0 299.34sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.08sec 0 299.34sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
purification protocol purification protocol heed_my_call 271685 87535 292 1.64 9109 18219 8.2 8.2 17.5% 0.0% 0.0% 0.0% 33.45sec 87535 299.34sec
purification protocol purification protocol heed_my_call_aoe 271686 37707 126 1.64 3903 7811 8.2 8.2 18.1% 0.0% 0.0% 0.0% 33.45sec 37707 299.34sec
purification protocol purification protocol lunar_strike 194153 1485963 4964 15.22 16599 33170 75.9 75.9 18.0% 0.0% 0.0% 0.0% 3.85sec 1485963 299.34sec
purification protocol purification protocol moonfire 8921 47248 158 2.81 2856 5711 14.0 14.0 17.8% 0.0% 0.0% 0.0% 21.32sec 730405 299.34sec
purification protocol purification protocol moonfire ticks -8921 683157 2277 44.07 2629 5253 14.0 220.4 18.0% 0.0% 0.0% 0.0% 21.32sec 730405 299.34sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
purification protocol purification protocol purification_protocol 295293 180580 603 3.30 9295 18599 16.5 16.5 17.8% 0.0% 0.0% 0.0% 17.46sec 180580 299.34sec
purification protocol purification protocol purifying_blast 295337 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.38sec 0 299.34sec
purification protocol purification protocol purifying_tick ticks -295338 202205 674 0.00 4534 9069 37.9 0.0 17.7% 0.0% 0.0% 0.0% 7.63sec 202205 299.34sec
purification protocol purification protocol shooting_stars 202497 237190 792 8.83 4562 9119 44.0 44.0 18.1% 0.0% 0.0% 0.0% 6.58sec 237190 299.34sec
purification protocol purification protocol solar_wrath 190984 827215 2763 18.39 7644 15278 91.2 91.8 17.9% 0.0% 0.0% 0.0% 3.21sec 827215 299.34sec
purification protocol purification protocol solar_empowerment 279729 483386 1615 14.68 6602 0 73.2 73.2 0.0% 0.0% 0.0% 0.0% 3.99sec 483386 299.34sec
purification protocol purification protocol starsurge 78674 3495037 11676 12.06 49268 98419 60.4 60.2 18.0% 0.0% 0.0% 0.0% 4.99sec 3495037 299.34sec
purification protocol purification protocol stellar_flare 202347 35931 120 2.55 2397 4790 12.7 12.7 17.9% 0.0% 0.0% 0.0% 23.57sec 473897 299.34sec
purification protocol purification protocol stellar_flare ticks -202347 437966 1460 43.60 1704 3404 12.7 218.0 17.9% 0.0% 0.0% 0.0% 23.57sec 473897 299.34sec
purification protocol purification protocol streaking_stars 272873 1710233 5713 17.78 16355 32704 88.7 88.7 17.9% 0.0% 0.0% 0.0% 3.12sec 1710233 299.34sec
purification protocol purification protocol sunfire 93402 82637 276 3.59 3914 7835 17.9 17.9 17.8% 0.0% 0.0% 0.0% 16.62sec 813313 299.34sec
purification protocol purification protocol sunfire ticks -93402 730675 2436 43.90 2823 5643 17.9 219.5 17.9% 0.0% 0.0% 0.0% 16.62sec 813313 299.34sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.47sec 0 299.34sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.09sec 0 299.34sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
ripple in space ripple in space heed_my_call 271685 87594 293 1.63 9108 18214 8.2 8.2 17.9% 0.0% 0.0% 0.0% 33.42sec 87594 299.34sec
ripple in space ripple in space heed_my_call_aoe 271686 37487 125 1.63 3903 7811 8.2 8.2 17.7% 0.0% 0.0% 0.0% 33.42sec 37487 299.34sec
ripple in space ripple in space lunar_strike 194153 1521524 5083 15.22 16983 33954 75.9 75.9 18.0% 0.0% 0.0% 0.0% 3.84sec 1521524 299.34sec
ripple in space ripple in space moonfire 8921 48714 163 2.82 2936 5868 14.1 14.1 18.1% 0.0% 0.0% 0.0% 21.31sec 748641 299.34sec
ripple in space ripple in space moonfire ticks -8921 699927 2333 44.06 2694 5382 14.1 220.3 18.0% 0.0% 0.0% 0.0% 21.31sec 748641 299.34sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
ripple in space ripple in space ripple_in_space 302731 103749 347 1.09 19114 0 5.5 5.4 0.0% 0.0% 0.0% 0.0% 60.36sec 103749 299.34sec
ripple in space ripple in space shooting_stars 202497 242818 811 8.82 4675 9334 44.0 44.0 18.1% 0.0% 0.0% 0.0% 6.59sec 242818 299.34sec
ripple in space ripple in space solar_wrath 190984 848902 2836 18.38 7845 15690 91.2 91.7 18.0% 0.0% 0.0% 0.0% 3.22sec 848902 299.34sec
ripple in space ripple in space solar_empowerment 279729 496169 1658 14.67 6780 0 73.2 73.2 0.0% 0.0% 0.0% 0.0% 3.99sec 496169 299.34sec
ripple in space ripple in space starsurge 78674 3569836 11926 12.06 50337 100551 60.3 60.1 17.9% 0.0% 0.0% 0.0% 4.99sec 3569836 299.34sec
ripple in space ripple in space stellar_flare 202347 36658 122 2.55 2444 4893 12.7 12.7 17.9% 0.0% 0.0% 0.0% 23.57sec 485291 299.34sec
ripple in space ripple in space stellar_flare ticks -202347 448633 1495 43.59 1745 3489 12.7 218.0 18.0% 0.0% 0.0% 0.0% 23.57sec 485291 299.34sec
ripple in space ripple in space streaking_stars 272873 1708626 5708 17.77 16351 32706 88.6 88.6 17.9% 0.0% 0.0% 0.0% 3.13sec 1708626 299.34sec
ripple in space ripple in space sunfire 93402 84788 283 3.59 4018 8025 17.9 17.9 17.9% 0.0% 0.0% 0.0% 16.64sec 833389 299.34sec
ripple in space ripple in space sunfire ticks -93402 748602 2495 43.89 2893 5780 17.9 219.5 17.9% 0.0% 0.0% 0.0% 16.64sec 833389 299.34sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.42sec 0 299.34sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.07sec 0 299.34sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
unbound force unbound force heed_my_call 271685 89922 300 1.62 9107 18224 8.1 8.1 21.8% 0.0% 0.0% 0.0% 33.85sec 89922 299.34sec
unbound force unbound force heed_my_call_aoe 271686 38518 129 1.62 3903 7811 8.1 8.1 21.7% 0.0% 0.0% 0.0% 33.85sec 38518 299.34sec
unbound force unbound force lunar_strike 194153 1518886 5074 15.24 16587 33110 76.0 76.0 20.5% 0.0% 0.0% 0.0% 3.83sec 1518886 299.34sec
unbound force unbound force moonfire 8921 48730 163 2.81 2856 5696 14.0 14.0 21.7% 0.0% 0.0% 0.0% 21.32sec 751829 299.34sec
unbound force unbound force moonfire ticks -8921 703099 2344 44.08 2630 5240 14.0 220.4 21.4% 0.0% 0.0% 0.0% 21.32sec 751829 299.34sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
unbound force unbound force shooting_stars 202497 244353 816 8.81 4566 9087 44.0 44.0 21.9% 0.0% 0.0% 0.0% 6.60sec 244353 299.34sec
unbound force unbound force solar_wrath 190984 847598 2832 18.48 7639 15258 91.7 92.2 20.4% 0.0% 0.0% 0.0% 3.20sec 847598 299.34sec
unbound force unbound force solar_empowerment 279729 493850 1650 14.69 6740 0 73.3 73.3 0.0% 0.0% 0.0% 0.0% 3.99sec 493850 299.34sec
unbound force unbound force starsurge 78674 3586088 11980 12.08 49266 98235 60.5 60.3 20.9% 0.0% 0.0% 0.0% 4.98sec 3586088 299.34sec
unbound force unbound force stellar_flare 202347 36920 123 2.55 2400 4790 12.7 12.7 21.1% 0.0% 0.0% 0.0% 23.57sec 487878 299.34sec
unbound force unbound force stellar_flare ticks -202347 450958 1503 43.62 1704 3397 12.7 218.1 21.5% 0.0% 0.0% 0.0% 23.57sec 487878 299.34sec
unbound force unbound force streaking_stars 272873 1730382 5781 17.67 16349 32710 88.1 88.1 20.1% 0.0% 0.0% 0.0% 3.14sec 1730382 299.34sec
unbound force unbound force sunfire 93402 85324 285 3.59 3919 7804 17.9 17.9 21.6% 0.0% 0.0% 0.0% 16.59sec 837627 299.34sec
unbound force unbound force sunfire ticks -93402 752303 2508 43.92 2825 5627 17.9 219.6 21.4% 0.0% 0.0% 0.0% 16.59sec 837627 299.34sec
unbound force unbound force the_unbound_force ticks -298452 332803 1109 7.90 1321 6799 5.0 39.5 76.3% 0.0% 0.0% 0.0% 67.17sec 332803 299.34sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.67sec 0 299.34sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 154.57sec 0 299.34sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
visions visions heed_my_call 271685 90434 302 1.67 9195 18390 8.3 8.3 18.1% 0.0% 0.0% 0.0% 32.68sec 90434 299.34sec
visions visions heed_my_call_aoe 271686 38760 129 1.67 3941 7882 8.3 8.3 18.1% 0.0% 0.0% 0.0% 32.68sec 38760 299.34sec
visions visions lunar_strike 194153 1579321 5276 15.79 17003 33989 78.8 78.8 17.9% 0.0% 0.0% 0.0% 3.72sec 1579321 299.34sec
visions visions moonfire 8921 48796 163 2.85 2907 5807 14.2 14.2 17.9% 0.0% 0.0% 0.0% 21.19sec 767174 299.34sec
visions visions moonfire ticks -8921 718378 2395 45.05 2705 5405 14.2 225.2 17.9% 0.0% 0.0% 0.0% 21.19sec 767174 299.34sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
visions visions shooting_stars 202497 249123 832 9.01 4696 9385 44.9 44.9 18.1% 0.0% 0.0% 0.0% 6.50sec 249123 299.34sec
visions visions solar_wrath 190984 882608 2949 19.02 7884 15758 94.3 94.9 18.0% 0.0% 0.0% 0.0% 3.12sec 882608 299.34sec
visions visions solar_empowerment 279729 526437 1759 15.50 6809 0 77.3 77.3 0.0% 0.0% 0.0% 0.0% 3.79sec 526437 299.34sec
visions visions starsurge 78674 3812173 12735 12.78 50723 101297 64.0 63.7 18.0% 0.0% 0.0% 0.0% 4.73sec 3812173 299.34sec
visions visions stellar_flare 202347 37288 125 2.56 2475 4949 12.8 12.8 18.1% 0.0% 0.0% 0.0% 23.57sec 498014 299.34sec
visions visions stellar_flare ticks -202347 460726 1536 44.57 1753 3504 12.8 222.8 18.0% 0.0% 0.0% 0.0% 23.57sec 498014 299.34sec
visions visions streaking_stars 272873 2540746 8488 26.16 16518 33047 130.5 130.5 17.9% 0.0% 0.0% 0.0% 2.21sec 2540746 299.34sec
visions visions sunfire 93402 85042 284 3.60 4019 8040 17.9 17.9 18.0% 0.0% 0.0% 0.0% 16.69sec 853866 299.34sec
visions visions sunfire ticks -93402 768824 2563 44.87 2905 5807 17.9 224.4 18.0% 0.0% 0.0% 0.0% 16.69sec 853866 299.34sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.44sec 0 299.34sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 183.16sec 0 299.34sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
worldvein worldvein heed_my_call 271685 87788 293 1.64 9107 18216 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.19sec 87788 299.34sec
worldvein worldvein heed_my_call_aoe 271686 37626 126 1.64 3904 7803 8.2 8.2 18.0% 0.0% 0.0% 0.0% 33.19sec 37626 299.34sec
worldvein worldvein lunar_strike 194153 1593829 5324 15.21 17796 35583 75.9 75.9 18.0% 0.0% 0.0% 0.0% 3.84sec 1593829 299.34sec
worldvein worldvein moonfire 8921 50636 169 2.82 3058 6121 14.1 14.1 17.8% 0.0% 0.0% 0.0% 21.32sec 782754 299.34sec
worldvein worldvein moonfire ticks -8921 732118 2440 44.07 2818 5632 14.1 220.3 17.9% 0.0% 0.0% 0.0% 21.32sec 782754 299.34sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.34sec
worldvein worldvein shooting_stars 202497 253432 847 8.80 4891 9769 43.9 43.9 18.1% 0.0% 0.0% 0.0% 6.62sec 253432 299.34sec
worldvein worldvein solar_wrath 190984 885990 2960 18.39 8190 16371 91.2 91.7 17.9% 0.0% 0.0% 0.0% 3.21sec 885990 299.34sec
worldvein worldvein solar_empowerment 279729 517191 1728 14.65 7077 0 73.1 73.1 0.0% 0.0% 0.0% 0.0% 3.99sec 517191 299.34sec
worldvein worldvein starsurge 78674 3720651 12430 12.05 52484 104904 60.3 60.1 17.9% 0.0% 0.0% 0.0% 4.99sec 3720651 299.34sec
worldvein worldvein stellar_flare 202347 38456 128 2.55 2568 5127 12.7 12.7 17.9% 0.0% 0.0% 0.0% 23.57sec 508131 299.34sec
worldvein worldvein stellar_flare ticks -202347 469675 1566 43.60 1827 3650 12.7 218.0 18.0% 0.0% 0.0% 0.0% 23.57sec 508131 299.34sec
worldvein worldvein streaking_stars 272873 1708963 5709 17.77 16353 32703 88.7 88.7 17.9% 0.0% 0.0% 0.0% 3.13sec 1708963 299.34sec
worldvein worldvein sunfire 93402 88781 297 3.59 4194 8388 17.9 17.9 18.2% 0.0% 0.0% 0.0% 16.61sec 872092 299.34sec
worldvein worldvein sunfire ticks -93402 783311 2611 43.90 3027 6049 17.9 219.5 17.9% 0.0% 0.0% 0.0% 16.61sec 872092 299.34sec
worldvein worldvein worldvein_resonance 295186 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.37sec 0 299.34sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
381474.5 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.47% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.48%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.60% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.37% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.37%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.11% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.11%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.55% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.55%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.98% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.98%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.29% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.29%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.80%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.76% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.76%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.06% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.06%

Trigger Attempt Success

  • trigger_pct:100.00%
Blood of the Enemy 2.0 0.0 182.9sec 182.9sec 6.77% 9.12% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_blood_of_the_enemy
  • max_stacks:1
  • duration:10.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_of_the_enemy_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297108
  • name:Blood of the Enemy
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing $s1 Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Condensed Life-Force (condensed_life_force) 10.8 59.4 28.5sec 4.1sec 44.09% 0.00% 59.4(59.4) 10.5

Buff details

  • buff initial source:life-force
  • cooldown name:buff_condensed_life_force
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • condensed_life_force_1:44.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295838
  • name:Condensed Life-Force
  • tooltip:Damage taken increased by $s1%.
  • description:{$@spelldesc295837=When an Azerite spike deals damage, all damage you deal against that target is increased by $295838s1% for {$295838d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 381474.45
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 7672
Mean 299.34
Minimum 240.00
Maximum 359.99
Spread ( max - min ) 119.99
Range [ ( max - min ) / 2 * 100% ] 20.04%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 7672
Mean 408036.82
Minimum 387103.59
Maximum 432264.32
Spread ( max - min ) 45160.73
Range [ ( max - min ) / 2 * 100% ] 5.53%
Standard Deviation 8260.8966
5th Percentile 395480.45
95th Percentile 421354.91
( 95th Percentile - 5th Percentile ) 25874.46
Mean Distribution
Standard Deviation 94.3133
95.00% Confidence Intervall ( 407851.97 - 408221.67 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1575
0.1 Scale Factor Error with Delta=300 582557
0.05 Scale Factor Error with Delta=300 2330226
0.01 Scale Factor Error with Delta=300 58255648
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 7672
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2105
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 107195944 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n